Home | About Us | Hotline/KDX | Support | Forums
The preterhuman.net network relies on contributions from its users to maintain services. Advertising and affiliate links on this site do not provide enough income to cover the hosting costs. For donations of hardware and software, please visit this page. For PayPal and Bitcoin/Litecoin donations, please use the buttons above.
Filename Type Size Date Modified
../
'Affirmative Action' Chief Latest 'Victim' of Katrina_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Anti-Semitism' Center Set Up at Yale_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Border Baby' Boom Strains South Texas_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Down Low' Lifestyle Causing AIDS Epidemic Among Blacks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Down Low' Lifestyle Suspected in Porn Industry HIV Scare_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Gay' Groups Fight Parents Over School's Mandatory Homosexual Indoctrination_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Governator' Refuses Tookie Clemency_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'IQ' vs. Standardized Tests_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'I Was a Victim of Racial Violence in Junior High'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Madonna' - Diva of Degeneracy to Perform in Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Mighty Whitey' Defends Algiers Point_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Mud Duck' - Vang Trial Hits Emotional Peak_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Neutral' Official to KLA - 'Careful With Those Grenades'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Sugar daddies' fuelling HIV spread_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Tolerance' Runs Out for Firm_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Voices of Heaven' Ordered Not to Sing Sacred Music_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
2 standards for diversity in the legal fraternity_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
9-11 Families Demand Action on Immigration_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
15,000 Hmong Head for Minnesota_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
50 Cent Gives New Meaning to 'Da Bomb'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
100 Million Dead - JEWS AND COMMUNISM Part 1_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
100 Million Dead - JEWS AND COMMUNISM Part 2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
100 Million Dead - JEWS AND COMMUNISM Part 3_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
260 million CHRISTIAN Lives Lost_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
2005-12-07 - Wanted - More Race Realism, Less Moralistic_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
2005-12-07 - wanted_more_race_realism_less.php_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Abandoned and Betrayed_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Abandoned Gold Standard Guarantees Inflation_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ABC Targets White Children_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Accused Negro Sniper to 'Question' His White Victim_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ACLU Top Heavy with Jews_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Date with Bevin_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ADL's Foxman - New Testament is Anti-Semitic_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ADL Anti-Defamation League of B'nai B'rith conducts smear campaigns - ADL Anti-Defamation League of B'nai B'rith is caught in cover-up of its crimes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ADL Briefs U.S. House on Internet 'Hate'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ADL Demands Gulag for Dissenters_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ADL Führer Warns of 'Intermarriage' and Public Schooling_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ADL Opponents Officially Designated As 'Terrorist Organizations'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Adorno's Bastards and the Frankfurt School_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ads Declare Population Driven Environmental Crisis In California_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Advice on building an electric car for those interested_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Africa In Our Midst - Lessons From Katrina_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
African 'Culture' Spreads HIV_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
After Millennia in India, Lost Tribe Returns to Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Agitprop_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Great Day in L.A._files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Group of Friends - Magnet For A Lonely America_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
AIDS Alert! Avoid Sugar Daddies!_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
AIDS Epidemic Among Black Elite_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
AIPAC Congratulates Itself on the Slaughter in Lebanon_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
AIPAC Espionage Case Dismissal Gambit Fails_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
AIPAC Scandal Breaks Loose_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
AIPAC Warns Dems Not to Appear at Anti-war Demo_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Alabama - Immigrants Make School Rolls Larger than Town_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Alan Stang - 2004-01-16 - 'Martin Luther' King - Communist Fraud_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ali G Worries ADL_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Alleged Racial-Beating Victim Admits Concocting Story_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Look Back at Revisionism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Alpin MacLaren - 2006-01-06 - Cold Turkey - Multiracialism is destroying our schools_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Alpin MacLaren - 2006-02-09 - Civil Wrongs_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Alpin MacLaren - 2006-03-02 - When Logic Fails_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Man Named Arkan_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
America's Middle Class Shrinking in Globalist Economy_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
America's Most Powerful Hate Group_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
America Disappearing_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
America Firster Jew Exposes Israel and the Zionist Network_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Americans Say Enough is Enough! Miller Beer Boycott Update_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Amid Katrina Chaos, Congressman Used National Guard to Visit Home_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Mile Too Far_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Minuteman Boosts Border Overhaul Reform_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Anarcho-Tyranny—Where Multiculturalism Leads_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A National Emergency_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Andrew Young Pulls a 'Mel Gibson'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A New Commission for a New Era_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Anti-Child-Molester Protest Stopped by 'Anti-Fascist Action'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Anti-White Discrimination Plagues European Art Scene_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Once Great Britain_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Apartheid State of Israel Expands Colonization of Golan Heights_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
AP In Hurricane 'Moral Equivalency' Hassle_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
AP Interviews Geert Wilders_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Apocalypse at Dresden - The Worst Massacre in the History of the World_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Apparent Drug Overdose Claims Life of National Vanguard Foe_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A review of La convergence des catastrophes by Guillaume Corvus_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Arm Against 'Katricians,' Gun Dealers Tell Houston_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Artful Anecdotes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Asians Murder British Lad for Being White_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A Split In the Racist Right_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Assassination Attempt on David Duke_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Assault Arrest Followed Word to Cheney_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A theory of Einstein the irrational plagiarist_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
August 23, 1917 - Black Mutiny Leaves 16 Whites Dead_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Australia - Rape Gangs and Multiracialism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Austrian court confirms British historian guilty of Holocaust denial_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Austrians Fed Up With Kosher Arnie_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Autumnal Equinox Comes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A V-Reader Gives Belgians a Message_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Avoid Mestizos - AIDS Rampant Among Mestizos_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A White Future is Coming - an interview with Bob Whitaker_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
A White Majority For New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Axe Wielding Albanian Mob Brutally Assaults Elderly Serb Couple in Kosovo_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Aztecs Butchered, Ate Prisoners_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Background on the Jewish Defense Organization_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Back to...Homeschool_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ban-Crazy Brits Nix St. George Again_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Baton Rouge Whites Mob Gun Stores_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
BBC To Report On London Kabbalah Center_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Beauty, Art, and Race_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Behind the Mask of Respectability - The truth about the Anti-Defamation League of B'nai B'rith_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Belgian Police Raid Revisionists_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Belgium - Multicultural Fascism Now Official Policy_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Beloved Wagnerian Soprano Passes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Benedict Meets with Dissident Journalist_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Benedict to Meet with Traditionalists_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Bergen's Lie_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Between the Jews and the Gentiles -- In the Aggadah, the Kabbalah, and in Jewish Thought_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Beyonce - 'I Make Black Records'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Beyond Chutzpah_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Birmingham Riots - Color is Only Skin Deep_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black 'Jews' Accused in Israeli Welfare Scam_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black Ex-Crack Salesman to Launch 'Books'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black God Begs Devil for Dignified Demise_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black HUD Chief Foresees a 'Whiter' New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black Leaders and the Demise of the OIC_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black Muslim Update - Oakland Store Arab Kidnapped_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Blackness Tells It Like It Be_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black Panther Foundation Seeks to Sell 'Burn Baby Burn' Hot Sauce_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black Panthers Jailed in Cop-Killing Probe_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black Refugee Accused of Raping Retarded Girl_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Blacks on New Orleans Looting Rampage_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black US Employees Accused of Slave-driving in Africa_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Black Vikings Fumble 'Ethics'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Blood on the Frost - Never Forget the Hmong Massacre_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
BNP Gets Voice on Yorkshire Race Council_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
BNP Leader Affirms - Islam 'Wicked' Faith_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Bombs and Hurricanes - Our Struggle_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
books-immigration_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Boycott Miller for Supporting Illegal Aliens and Illegal Immigration_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Brigham Young's Speech on Slavery, blacks and the Priesthood_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Britain Recruited Muslim Terrorists_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Britain’s Racial Diversity Brings Murder; No Justice_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Britons Pay Price for Neo-Con Madness_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Briton tells of Katrina nightmare_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Brooklyn-Based Jew Admits to Trafficking in Women_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Brooklyn - Black 'Students' Charged With Anti-White Race Attack_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Brooklyn Jew Ritually Murders Chickens_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Bush - It's All About the Spin_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Bush Buddy in Flap over Jewish 'Holy Water'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Bush Speech Gave Race Hustlers Fresh Ammo_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
By way of deception thou shalt do war_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
By Way Of Deception_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
California - April Gaede Awarded Queen Isabella Prize_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
California - Minuteman Won Election Day Vote_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
California - Pro-White Music At Folk The System_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
California - Tookie's Son on the Run_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
California - Tookie Executed_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
California Initiative for State Border Police Gaining Ground_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Can 'Liberals' Be Educated_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Cannibalism in the African Congo_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Cans of Paint, Two White Halves, and Chromosomes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Challenging the Power of the Jewish Lobby - What Should Be Done_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Challenging the Power of the Jewish Lobby_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Chavez Condemned for 'Anti-Semitism'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Cherishing an Older Catholicism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Chertoff Aide Guilty in Child Porn Case_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Chertoff Claims He Didn't Have A Clue_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Chertoff Proposes Non-Profit Spying Group_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Chertoff Timeline_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Children - National Treasure or Personal Luxury Item_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
China, Deflation And The Dollar_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
China Replaces U.S. As World's Largest Exporter_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Chosen for Pornography_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Christian Colleges Offer Free Tuition to Katrina Refugees_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Christians in Jerusalem Want Jews to Stop Spitting on Them_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Church asks evacuee to leave_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Church fighting IRS over anti-war sermon won't give up documents_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Churchill's War/ <Directory> <Directory> Oct 5 2015 1:52 AM
Chutzpah - Zionists Running Anti-Slavery Organization_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Civil War in Europe_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Colorado - 57 Refugees Have Felony Records_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
CompleteGuide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Confirmed - Snipers Black_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Congressional Black Caucus Holds Press Conference_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Congressman Apologizes, Denies Assaulting Mistress_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Contemporary Trotskyism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Controlled Media - Forget the Facts About Katrina_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Corrupting Our Police_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Court Temporarily OKs Domestic Spying_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Court to Tookie - No Thanks, Snitch_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Creationism and Truth_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Crime Cover-Up in DC_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Criticism is Not Hate_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Curt Maynard - 2006-07-02 - A Frank Discussion of Jewish Group Dynamics_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Czech Gets Expensive Lesson_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dallas Cops Nix Katrina Officers_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dan Osterton - 2006-07-20 - The Necessity of Invasion_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Daryl Bradford Smith - Prepare for the upcoming battle_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
David Daugherty - 2006-02-09 - Thanks, We Have Our Own Media Now_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
David Irving the 'Anti-Semite'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
David Lane - Dissension in the Ranks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
David_Lane - The Final Address of David Lane to the Jury_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dealing With the Peak Oil Critics_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Death Gate Cycle/ <Directory> <Directory> Oct 5 2015 1:52 AM
Debating the Lobby_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Deejay - 'I'm Coming for Your Seed'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Deejay’s Appeal - ‘Kill the Whiteness Inside’_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Defense Firms Making a Killing on Iraq War_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Defensible Racism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Democrats Condemn Chertoff's Incompetence_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Denver National Vanguard - Supporting the Columbus Day Parade_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Desperate Jewish News Outlets Abandoning Last Pretenses of Honesty_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Devil's Advocate - The Chinese Have Guts_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Did Arabs Accidentally Get Canned Pork By Mistake_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Did Time Magazine Lie to Pad Circulation_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Disaster Buck Stopped at Chertoff, Not Brown_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Discussing Race in a Globalized World_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Diversity Can Only Be Countered With Brutality And War_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dividing the World_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Do Blacks Deserve Billions for Slavery_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Do They Think It’s Worth It_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Do Whites Really Deserve to Exist_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dr. Lorraine Day’s Response to Judy Andreas - zionism -_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
DR Congo's atrocious secret_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dreaming of a Black Christmas_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dream of inter-racial cooperation finally a UK reality_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Drug Feud Claims Life of Anti-White Activist_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dumbing Down America_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dutch Inquisition Reborn_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Dutch to Become First European Nation to Ban Burka_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ebonics Suggested for District_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Editing Martin Luther King, Jr_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Educational Sabotage_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Educators Baffled at Stubborn Achievement Gap_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Edward Fagan Sues Lloyd's of London, U.S. Government_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
einstein-prioritymyth_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
EinsteinStoleE=mc2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Eire - YOU DID IT! Now Let's Build On the Success_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Elizabeth Smith - A Woman Looks at the Lifetime Channel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Empowerment by Rape - the Sexual Holocaust_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ending the Dollar's Tyranny_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
End of an Era - Spearhead to Close_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
End of the Rainbow_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
England Prepares to Honor Millenium of First Patron Saint_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
English Lad 'Too Pale'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Englishman's Zimbabwean Road Trip to Texas_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Enron - A Microcosm of America_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ethiopian Government Begs After Bumper Crop_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Euro 2005 DVD_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
European Origins of Halloween_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Europeans Having Second Thoughts about Turkey_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
European Union Applies 'Hate Speech' Rules to Internet_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Europe’s Successful Moon Probe Mission_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Euro Slurs and Hate Caricatures_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ex-IRA Soldier Condemns Loss of Traditional Ireland_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ex-Security Chief Blows Whistle on UN's Kosovo Mission_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Exercise, It’s Not What Your Doctor Prescribed_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Facts To Consider Concerning The Holocaust_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Fading Illusions - D-Day and Reagan_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Fagan Files $1 Billion 'Holocaust Compensation' Lawsuit_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Failures of Our Age - Capitalism and Communism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Famous people with Scotch Irish blood_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Farewell to a Good European_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Fast Times at Regnef High - crying-wolf_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Fear and Illusion_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Feds Say Katrina Refugee Gangs a Threat_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Fewer Than 50,000 Whites in Zimbabwe_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Fighting Organized Crime_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Final Verdict - The false connection between Tim McVeigh and The Turner Diaries_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Finkelstein Debates Israeli Pol_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Five Myths That Sanction Israel's War Crimes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Florida - 'King Tut' Prompts Black Protests_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Florida - Homeowners Association Says 'No' to Evacuees_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Florida - Vote Ubele_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Florida School Board Rejects Hall's Resignation_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Foreword to the new edition - Zundel's Story_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Forgotten Realms/ <Directory> <Directory> Oct 5 2015 1:52 AM
Former Reps. Earl Hilliard (D-Ala.) and Cynthia McKinney (D-Ga.) - Bad for Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
France - Chirac Calls for Police State to Enforce Multiracialism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
France - Teacher in Hiding_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
France - Turks Must Admit Genocide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
France Lays Dauphin to Rest_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Frank Roman - 2006-10-07 - Impeach The System_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Free Pro-European Music_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Free Speech Can Be Fatal_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Friends of Ulster - USA Scotch Irish _ Ulster Scots_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Front National MP Suspended from Teaching Position for Calling for Open Debate_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Full Text of Ahmadinejad's Letter to Merkel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Genes Trace the Ancient Wanderings of White People_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Genetic Branching - Keep it Going_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
German Politicians Talk Turkey_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Germany - PC Gift to Patriots_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
God, Religion, and Tribal Conflict_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
good_jewbad_jew_paradigm - The Mindset that Impedes Civilization's Healing Process_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Governor Schwarzenegger's Statement Denying Tookie Clemency_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Guilt March Hosts Named For Plagiarist_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Guts - A White Man Who Won't Back Down_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Guy Ritchie - Kabbalah Ruined My Film_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Half of Katrina Refugees Are Criminals_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hans Christian Andersen (1845) - Holger Danske_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Happy German-American Day_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Has King Tut Been 'Whitewashed'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Head of Homeland Security Has Ties With Suspected Financier of 911_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Heather Mac Donald on Immigration on National Review Online - A Latin conservative tidal wave is not coming_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Henry Ford - 1922-01-07 - Candid Address to Jews on the Jewish Problem_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Henry Kissinger - The Walking, Talking Conflict of Interest_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
hey're Not All Bad...Are They_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hezbollah Broke Israeli Codes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
High Druid of Shannara/ <Directory> <Directory> Oct 5 2015 1:52 AM
High School Failure Rate Highest in Non-White Districts_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hilarious PC Language Lesson_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Historical Myth Justifies Golan Heights Occupation_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Historical Revisionism – International and Independent Scientific Historical Research/ <Directory> <Directory> Oct 5 2015 1:52 AM
H Millard - Homeless Jack on Iran, Freedom, Intellectuals, and the Holocaust_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hmong Immigrant Commits Mass Murder in Northern Wisconsin_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hockney's Secret Knowledge - Refuted_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Holger Dansk - Denmark's Mountain King_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hollywood Slanders Italian Americans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Holocaust Fraud_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Holocaust Hoax to be Hammered at Upcoming Conference in Iran_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Holocaust Lawyer Faces $3.2 Million Malpractice Judgment_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Homeland Security's Casualties_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Homeland Security Nominee Chertoff Aided 9-11 Terror Suspect_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Homeless Jack Offers a Primer_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Homeless Jack on New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Home on the Range_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Homosexual Groups Trying to Distance Themselves From Foley_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Honoring Robert E. Lee_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Houston - Turf War Breaks Out between Katrina Refugees, Locals_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
How Many More Nations Will Israel Attack_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
How Many Tanks Did Israel Lose_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
How Muslims Deal With Third World Immigrants_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
How New Orleans Was Lost_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
How Small Genetic Differences Give Racial Divergency_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
How Unskilled Immigrants Hurt Our Economy_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hugo Chavez - Rise Up Against the Empire_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hurricane Katrina - Blacks Worsen Disaster_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hurricane Katrina and Black Behavior_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hurricane Katrina Devastates Duke Headquarters_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Hushed-up Israeli Spy Operations against USA and Mexico 2000 - 2003_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
If You Tolerate This..._files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Igniting the Spark - An Interview With David Duke_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Illegal Immigration - War with Mexico Approaches_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Illegal Immigration and the Racism of 'Antiracism'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Illegal Immigration Sparks Race War in Cities, Prisions_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Illegals Demand the 'Right' to Break the Law_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Illinois Cops - Arabs Beat, Gas Black_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Indian Schools, Genes, Assimilation, and Illegal Aliens_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Indians Reject Black Claims_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Indicted - Republican Corporate Whore DeLay Resigns_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
In Italy, Al Qaeda Turns to Organized Crime for Protection_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
In Praise of Saudi Arabia_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Institute for Political & International Studies_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Interracial Rape Victim - Called by God to 'Minister Against Racism'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Interview with the Grim Reaper - StantonReaper0905_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Introducing the Global I.D. Card_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Iran - The 'Holocaust' Threat to World Peace_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Iranians Produce Holocaust Cartoons_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Iraq - Christians Leery of Islamic 'Tolerance'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Iraq at the Gates of Hell_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Iraqi Resister - Black Soldiers are Targets_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Irish Academics Urge Israel Boycott_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Irreconcilable Differences_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Is any of this stuff made in Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Is Europe Unable to Assimilate Its Growing Islamic Minority_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Islamic Headscarf Ban Debate Hits Australia_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Islamic Wisdom - 'Rapist' Jailed, 'Victim' Executed_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Islamists Throng in Europe's Powder Keg_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Islam versus Christianity – A reply to The Pope!_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Is Neocon Spokesman Soliciting Murder of David Duke_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel's Interior Minister - 'Stop Spitting on Christians'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel's Sex-Slave Industry Soars_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel - Beyond Good and Evil_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel - New Party Urges Expulsion of Non-Jews_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel - Poll Shows 64 Percent of Israeli Jews Favor Ethnic Cleansing_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel - Was BBC's Peter Hounam Arrested as Punishment_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel Honors Jewish Terrorists Who Attacked America_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli-Sponsored Educational Program for NY Schools_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli Gangster Shot Dead in Russia_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli Minister Calls for Nasrallah's Death_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel in Hot Water Over New Zealand Spies_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli Nuclear Whistleblower Vanunu Speaks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli PM's party plagiarizes from Texas Democrats_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
IsraeliPrimeMinisterDeclaresJewWarOnIranAndSyria_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israelis Among the Holocaust Deniers_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli Sexpionage - The McGreevey, Condit and Clinton Affairs_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israelis Launch Voting Guide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli Sniper Assassinates Two Children_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli Spying - The Mother of All Scandals_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israelis Win Contract To Secure US Borders_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli troops seize million dollars in bank raids across West Bank_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israeli Website Exposes Jewish Extremism!_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel Loan Program Limited to Jews_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel Lobby Denial_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel Pushing U.S. to Bomb Iran_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Israel Wants IAEA to Ignore its Nuclear Arsenal, Concentrate on Iran_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Is There Some Bravery Left in Braveheart_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
It's 1984 in Massachusetts – And Big Brother Is Gay_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
It's Coming to America, Too_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
It's the Genes, Stupid!_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
I Was Israel’s Dupe_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jagger Rejects Kabbalah after Extortion Attempt_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
James and Cindy; Progress and Hope_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Janis Ian - 2002-09-16 - THE INTERNET DEBACLE – AN ALTERNATIVE VIEW_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
JB Cash - 2006-01-05 - Death of a Hero_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
J Dub Gettin’ Funky in Durham_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jeff A. Taylor - 2006-07-24 - Rah-Rah IDF_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jerry Falwell Now Supports 'Gay' Rights_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
jew-occupiedgovernments-USSR-moreevidence - Historical Sources_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
jew-organizations-JDL-Zionist-Terror-Network-IHR_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish 'Muslim' Threatens West with Genocide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Academic Blasts Middle-class Whites for Not 'Integrating' Kids_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Anti-Gentile Hatred in Porn Industry_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Censors Seek to Ban Dissident White Historian_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Genetic Diseases 2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Genetic Diseases_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Lawyer Edward Fagan to Sue African Marxists_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Leader Calls On Zionists To Kill All Palestinian Males_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Mafia Expands White Slave Trade to London_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Porn King May Have Skipped to Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish rabbi calls for extermination of all Palestinian males_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Support for Open Borders - Is it Biological_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Supremacist Michael Chertoff Named Head of Homeland Security_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Supremacists Shaping Election of UN Secretary General_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Terrorist Gets Prison_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Usury and Finance Capital_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Voters Object to New Polling Place2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish Voters Object to New Polling Place_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jewish WMD Whistleblower Vanunu Released But Not Free_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jews - A Religious Community, a People, or a Race_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
jews beat Santa Clause_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jews Relentless In Pursuit of Internet Censorship_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jew Threatens LA With New 9-11_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
JewWatch/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jingle Jam Chaos Closes Minnesota Mall_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
John Barleycorn_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution, continued_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
John H. Campbell - The Moral Imperative of Our Future Evolution_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
John Tyndall - An Anagogical View of Empire_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Journalist Held In Dungeon Of Filth_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Judea declares war on Germany_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Judeo-Fascism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Jury Selection to Be Moved in Bloodbath Trial_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kaballah Crazy!_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kabbalah Red String Market Threatened_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kathleen Christiso - 2006-09-12 - The Coming Collapse of Zionism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina, Iraq, and the Know-It-All Syndrome_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina - Neo-con Pals Rake in the Dough_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina and the Black Tsunami_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Black Tells Fox You Owe Him_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Evacuee Charged with Child Murder_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Evacuees Binge on Cape Cod_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Students Spark Constitutional Debate_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Tensions - School Official Resigns over Remarks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Threatens Croatian-American Tradition_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Threatens to Swamp Utah_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Unleashes HIV+ Horde_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Katrina Victims Unwelcome in Some Towns_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kenya - Black Priest Kills White Roman Catholic Bishop_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kill Arabs, Cry Anti-Semitism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Killer Plays Race Card_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kill the Christians_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kirkby TV Covers Reconquista_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kook Conspiracy Theories - Reject Them_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Kosovo - A Dangerous Cosmetic Salon_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Lamb Gaede - 11-year-old White Girl Stands for Truth in California_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Lambing Flat_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Land Of Dope And Jewry_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
La Pauvre Petite - Schoolgirl abduction-murder rivets France_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Lapdance King, Lawyer Indicted in 'Mafia' Probe_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
La Raza List of Corporate Traitors_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Law Enforcement Embattled in New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Leftist Violence Flares at Norwegian Election Event_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Letter - A Father Pleads for His Son's Future_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Letter from Atlanta - The Seamy Gold Club Trial_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Liberating America From Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Lisa Rad - 2006-02-15 - Fall of the Fourth Reich_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
list-of-jews_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
London - Jewish Mafia Loses Three Soldiers_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
London Mayor Challenges Suspension_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Louisiana - Town's First Black Police Chief Charged in Crack Probe_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Louisiana National Guard Troops Watch Katrina from Iraq_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Louisiana Senator Threatens To Assault Bush_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Low-paid illegal work force has little impact on prices - 2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Low-paid illegal work force has little impact on prices_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
M. P. Shiel - 2006-03-07 - Equality, Democracy, and their Killing Fields_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Madonna Listed Among America's 'Most Powerful Jews'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mali - Africans Still Practice Human Sacrifice_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Marcus Epstein and Michelle Malkin_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Marian Evans -- Catastrophe in Kansas City_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mariel Deja Vu_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mark Weber - 2006-02-10 - Holocaust Survivor Memoir Exposed as Fraud_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mark Weber - 2006-03-16 - The Jewish Role in the Bolshevik Revolution and Russia's Early Soviet Regime_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Marshals - Innocent People Placed On 'Watch List' To Meet Quota_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Marxists Gamble on Geeks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
MaryPhaghanSong_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mass Grave Containing Kosovo Serbs Found_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mass Grave of Massacred Poles Found in Ukraine_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Matthew Downing - 2006-03-24 - Massachusetts - Pro-White Outreach Frustrates Local Media, ADL_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Matthew Hale - Justice Denied_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
mcveigh_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Media Note - 'Michael Savage' Lashes Out Against Nick Berg and His Family_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Medicating heretics_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mel Gibson's Anti-Zionist Priest Dies_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mel Gibson Denounces Jews' War_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Memo Proves Brown Paid for Chertoff's Incompetence_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Merry Christmas -- and on to Victory!_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mestizo Gangs Control the Suburbs_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mestizos too violent for open debate, crowd control impossible_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mexico Conquers Texas_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mexico Ups the Ante in Conflict with American Blacks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Michael Chertoff - 'Trust Us'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Middle Class Families in Worse Shape Than Ever, Study Finds_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Minnesota Shocker - Black Muslim Wins Primary_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Miscegenator Murders White 'Girlfriend' and Unborn Child_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mission Fights Eastern European Sex Slave Traffic_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mistrial for Accused Jewish Mafia Godfather_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mom Gives Kids Dose O’ Diversity_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
More 'Racist' AIDS Statistics_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
More Illegal Aliens Accused in Gang Rapes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
More Jewish Mobsters Arriving_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
More Legal Atrocities Against Serbian Whites_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
More on the Cabbala_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
More on the Orlando Sentinel's Campaign Against Free Speech and Thought_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mothers in Houston Join Katrina Altercation_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
MuadDib's Primer on the Jews_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Multicultural Jihad Wrecks Dutch Racial Harmony_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Multiracial Children Have More Psychological Problems_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Multiracialism and Conservatism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Museum Pulls 'Offensive' Artwork_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Muslim 'Tolerance' Boils Over in Egypt_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Muslims Back Down In Face of White 'Threat'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
My Big Biofuels Bet_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
MY FAREWELL TO ISRAEL_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Mystery of the mummies_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Myths, Misunderstandings, and Outright Lies - gold-confiscation-1933_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
N.O. Cops Suspected of Stealing Up to 200 Cars_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Namibia - Tribe Demands German Reparations_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
National Alliance Speaks at Campus Mideast Forum_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
National Vanguard - Just Say No to Illegal Immigrants_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
National Vanguard Activist Wins Victory Against Censorship_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Negro Accused of Spreading AIDS_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Nerds Join Neo-Cons to Oppose National Vanguard_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Netherlands - Jihadi Plot Upsets Liberals_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Netherlands Braces for 'Jihad'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Africa_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Book Helps White Families Become Prosperous_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Charges for Lightfingers Tom_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New From FEMA - The Looter Relocation Program_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Jersey - Jews Refuse to Vote in Churches_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Jersey Girl Murdered and Dismembered By Mestizos_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Jersey Icebergs and Whores_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Jersey Rabbi Says Katrina Refugees Welcome in Utah_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans - Cops Join in Looting_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans - Second Amendment Suspended_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans - The Rise of 'Mighty Whitey'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans Africa-Like Well Before Hurricane Katrina_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans and 'The Gods of the Copybook Headings'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans Chaos Reveals America on the Brink_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans Corrupt 'Down to the Bone,' Former Pol Charges_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans Descends into Africa-like Savagery_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans Parody Challenges System Media_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Orleans Pays For Affirmative Action_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Report Sheds Light on Hispanics in U.S._files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Sex Scandal Rocks Holy See_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Newspaper Calls Mass-Murder 'Sad' Flier Distribution 'Despicable'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Newsweek - Superlobbyist is Crooked_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New V-TV Video - Katrina Relief_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New Yorkers to study about Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
New York Times - Chertoff Approved Abu Ghraib Interrogation Methods_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Nick Griffin - The Race Murders the Media Ignore_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ninety_five_theses_on_the_holoca - Ninety Five Theses on the Holocaust_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
NJ - Mestizo Cop Helped Drug Ring Say Officials_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
NJ - New Black Panthers Come to Town_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
NJ Ethics Office - Fagan Stole $400,000_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
No, We're Not 'All Israelis Now'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
No Black Day in Jesse's Hometown_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
No Debit Cards for White People_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
noose_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Norman Language Flourishes in the Channel Islands_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
North American Students Trained for 'Merger'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Norway - 19,000 'Asylum' Seekers Evade Authorities_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Norwegian Patriots Demolish Sell-outs_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Norwegians Discover Joys of Islam_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Norwegian Teens Cool to 'Diversity'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Nutty Professor Charged In Hate Crime Hoax_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
NY Times Hit Hard as Controlled Media Take Continued Beating_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Oakland - Black-Yemeni Tension Ratcheted Up_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Oakland - Black Muslim Tensions Heightened_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Oakland - Blacks Loot Burned-Out Shell of Arab Store_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Oakland - Video Beating Victim Comes Forward_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Oakland Beating Video - Cops Baffled_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Oakland Update - Blacks Charged With Hate Crimes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
October 7, 1571 - The Deliverance of Europe at Lepanto_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Of Course There Is an Israel Lobby_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ohio - War Protest Turns Violent_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ohn Lennon's 'Imagine' (revised)_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Once We See Black We NEVER Go Back_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
One Percent of Population Commits Half of Homicides_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
On White Genocide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Over 75,000 AIDS Cases in New York City_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Patric Ewing testifies he twice had oral sex at Gold Club_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Pay No Attention to the Jews Behind the Curtain—the Iron Curtain_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
PC Desecration of Spanish Holy Site_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Peterloo Massacre_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Petty Criminal Leaves Sarkozy Red-Faced_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Poignant Photo Strikes Reader_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Poland Abruptly Cancels a Speech By Critic of the Jewish State_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Police - Hurricane Evacuees Kill Woman who Helped Them_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Police Demand Resignation of Black Commissioner_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Police Looting - Racial Realities Exposed in New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Police Ordered to Stop Looters_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Polish-Americans Celebrate Harvest Festival_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Polish Father of US Cavalry Laid to Rest_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Political Correctness - The Scourge of Our Times_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Political Prisoners - In America_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Poll Shows Rising Tide of anti-Semitism on Eve of Holocaust Day_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Polls Show Opposition to Iraq War at All-Time High_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Powerful Gains For Pro-Whites in Norwegian Elections_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Pre-Traumatic Stress Disorder-A Glimpse Into Israeli Collective Psychosis_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
President Putin - 'Orthodox Christianity an Integral Part of Russian Culture'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Pressure on Chertoff Builds_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Principal Negative Stereotypes Against European Americans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
printer.php_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Pro-Zionist Televangelist Advocates Murder_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Pro and Con - NFL Star Allegedly Runs Over Teens in Stolen Car_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Progress Party Gets It Right_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Prophecy of the Seeress_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Protestants and Catholics Unite -- For a Brown Ireland_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Protests Loom in Far West, Washington_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Prussian Blue and the First Amendment_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Purchasing Precious Metals_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Putin's Cannibals 'Gaffe'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Putin, the Patriot_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Putin - Those Who Bombed Serbia Should Pay Damages_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Putin Pilgrimage Strengthens Greco-Russian Links_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Questions of Preferential Treatment Raised in Sex Case_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Questions That May Not Be Asked About New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Rabbis to Israeli Military - Kill More Non-Jews_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Race-based Medicine Confirms Genetic Differences_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Race and Murder_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Race Baiting as New Orleans Sinks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Race in Ancient Egypt_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Racial Battle-Lines Divide School_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Racial Explosion 60 Years On_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Racialism versus Communitarianism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Racial Media Jump on Katrina News_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Racial Reality and the New Orleans Nightmare_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Racial Test Gap Remains Large in California_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Radical White Intellectual Predicts World-Altering Tempest_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Radio Station Urges 'Kill Tookie' Emails to Schwarzenegger_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ramadan Madness Looms_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Rap King Shot in Florida_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Reading, Writing and Race_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Real Racial Supremacism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Recent Events Show America is Changing_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Refugee Numbers On the Rise_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Religious Group Flagellate Selves Over 'Reparations'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Remember the Turkish Genocide of the Pontic Greeks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Report - Cannibalism in New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Report Illegal Aliens - status_report_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Republicans Back Pro-Homosexual 'Hate Crimes' Expansion_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Resisting Defamation - Principal Negative Stereotypes Against European Americans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Resisting Defamatory Anti-White Language_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Restoring The Small Farm_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
RESULTS OF MINNESOTA TRANSRACIAL ADOPTION STUDY_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Rhode Island - Cops Catch Illegals at Dem Chair's House_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Rockers Demand Recognition of Armenian Genocide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Rosa Brooks - Criticize Israel - You're an Anti-Semite_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Rural Traditions of the Pennsylvania Dutch Still Strong_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Russia - Sophisticated Sex Slave Operation Uncovered_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Russian State Duma Denounces Armenian Genocide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Russian Wealth in Hands of Jews - One Hundred Own Quarter of Wealth as Russians Starve_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Russia Ponders Tax on Childlessness_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
School Officials Look the Other Way When Whites are Abused_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Science Strikes Back_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Scotland - Poseurs Headed for Kneecapping_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Scotland - Race Killing Case Opens_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Seattle Test Scores Anguish_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Sex Offenders Slip Radar_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Sex Rabbi - 'I'll Debate David Duke'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Sharon - The Al Sharpton of the Middle East_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
shelby - Terrorism In South Africa_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Shmuley loses it_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Silver - Why You Should Own It_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Singapore Bloggers Latest Victims of Multicultural Intolerance_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Sinn Fein Touts for Third World Ireland at Westminster_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Sir Gawain and the Green Knight - Indo-European Archetypal Myth_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Slave Account - Fiction_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
So Long Tookie_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Some Comments on 'Racism'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Soros 'An Extremely Evil Person'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
So You Think You're a White Anti-Racist_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
So You Thought the Mob Was Run by Italians_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Specific Sites Excluded from Google.fr and or Google.de_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Spelling Used TV to Push Homosexual Agenda_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Spoof - Byzantine Emperor Apologizes to Muslims For Quote_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
St. George and the Harridan_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
St. Petersburg, FL - ethnic_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Stab in the Back - Israel’s Attack on the USS Liberty_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Stanford - Racial Groupings Match Genetic Profiles_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Steve E Romer - 2006-04-18 - Make Illegal Aliens Felons - That's Not Enough_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Steven E Romer - 2006-02-14 - Tiny Differences, Through Time, are Everything_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Stopping the Unstoppable_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Stop White Genocide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Strangers Among Us_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Strong Showing for BNP_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Subverting the Disney Legacy - Michael Eisner_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Supermob - Sidney Korshak and His Criminal Associates_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Support Freedom of Speech - Wear the Wristband_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Surrounded by Jews, Bush Blasts Mahathir, Says He's 'Wrong' About Jewish Power_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Survey - Israel is Number One Threat to World Peace_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Suspect - My Job Is 'Taking White People's Cars'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Swedes Arrest Alleged 'Anti-Fascist' Terrorist_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Swedes Embrace Inquisition_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Swiss Banks and the Jews - What Happened to the Extra Billion_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Synagogue Desecration Shocks London_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Syrians Snuff Islamist Attack on US_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Take Me to Your Moron_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tampa - When Whites Gather_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tampa Summer Solstice Festival_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Television Pioneer Elma Farnsworth Dies at 98_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Texas Papers Play Up 'Racial' Quotes by Candidate Friedman_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
thadanderson-American_Revolution_Docs/ <Directory> <Directory> Oct 5 2015 1:52 AM
thadanderson-Civil_War_Docs/ <Directory> <Directory> Oct 5 2015 1:52 AM
thadanderson-WWII_Docs/ <Directory> <Directory> Oct 5 2015 1:52 AM
That Which is Good, Shall be Called Evil_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The 'Holocaust' Is A Typical Zionist Myth_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The ADL, Jesus, and Anti-Semitism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The American Nation Part II_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The American Nation_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Anthrax Murders - The Israeli Connection, part 1_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Anthrax Murders - The Israeli Connection, part 2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
THE ARYANS, OR NOBLES_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Barack Obama Myth_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The BBC's One Way Racism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Beast as Saint - The Truth About 'Martin Luther King'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Biological Puzzle of Jewish Behavior_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Changing Face of AIDS_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
THE CHINK IN OUR ARMOR_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Christ-Killers Today_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Color Of Crime And The New Orleans Nightmare_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Confederate Defeat, The Fall Of New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Congo's Atrocious Secret_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dark Side of the Anti-Defamation League, part 1_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dark Side of the Anti-Defamation League, part 2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dark Side of the Anti-Defamation League, part 3_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dark Side of the Anti-Defamation League, part 4_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dark Side of the Anti-Defamation League, part 5_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dark Side of the Anti-Defamation League, part 6_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dark Side of the Anti-Defamation League, part 7_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dark Side of the Anti-Defamation League, part 8_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The De-Zionization of the American Mind_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Deadly Twins_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Destruction of White Youth_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dog Gone Asians_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Drunken Truth_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Dutch Say 'Nee!'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Eternal Value of Privacy_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Factory Farms of Jewish Publishing_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The FCC Scandal_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Forbidden Srebrenica Report - Something The Neo-cons Don't Want You To See_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Fraud of Neoconservative 'Anti-Communism'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Gateway_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Governors Declare An Emergency - Who Cares If They’re Sincere_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Hard Edge of Hatred_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Hidden History of 9-11-2001_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Hollywood Big Lie_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Holocaust Controversy - The Case For Open Debate_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Holy Man and the Ho_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Jewish Declaration of War_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
THE JEWS AND THE CONCENTRATION CAMPS - A FACTUAL APPRAISAL BY THE RED_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Jew Who Fled Rio_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Judas Goats_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Kwanzaa Hoax_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Last Straw - Jewish Death Squads in America_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Leo Frank case_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Liberty Tree_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Love of Ages_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Middle East Initiative_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Missiles at Ground Zero_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Most Corrupt Member of Congress_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Neo-Genocidists_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The New Minority_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Next Victims of Islamic Terror_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Officially Sanctioned Invasion of Greece_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Origins of the White Man - Part II_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Origins of the White Man - Part I_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Origins of the Word 'Racism'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Pope Must Die_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Price White Americans Pay - Never Forget the Hmong Massacre_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Racial Ideology of Empire_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Rednecks Did It!_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
There is No Freedom Without Free Speech_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Rise of the BNP_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Self-Evident Lessons of Madrid_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Shame of Being an American_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Shocking Story of Approved Killing in Mississippi_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Struggle for Caucasia_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Symbiants_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Tapes the Hague Tribunal Hasn't Shown - Muslim Terrorists Massacring Serbs_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Truth About Slavery_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The United States of Barbarism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Weird Wild World of the Zionist Right_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Weird World of Kwanzaa and Other African Hoaxes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Whitewashing of Ariel Sharon_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Winds of Change_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The World is His China Shop and His Shills Make Excuses_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The Wrath of Ka_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
They Want Our Kids_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
The_Jews_in_England_part2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
thinking_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
This Will Come Back to Haunt Us_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Thomas Carlyle and Edward Bulwer-Lytton - Giants of the North_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Thousands Protest Violence in Darfur_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Threats to a Free Internet_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
ThunderDome_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tiny Differences, Through Time, are Everything_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Today Show - Let 'Em Eat Cake_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tonight - Current Issues TV to Host Dr. David Duke_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Toni Morrison - She Simply Can't Write_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tookie's 'Peaceful' Pals Threaten Violence_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tookie Advocate - 'That’s a racist question!'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tookie Finally Ready to Snitch_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Too White, Too Strong_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Top Rabbi - Katrina is God's Punishment for Not Supporting Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tourists Evacuated from Superdome_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Tourists Targeted in New Orleans as Unrest Spreads to Baton Rouge_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Troops Back From Iraq Find Another War Zone_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Troops Find Grisly Scenes in New Orleans Convention Center_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast2_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Turkey, EU Reach Deal for Opening Talks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Turkey Has No Friends; Good for Europe_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Turkish Novelist Faces Jail for ‘Hate Speech’_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Turks Award Zionists with Weapons Contract_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Turks Convict Armenian Journalist of 'Speech Crime'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Turks May Save Drowning Rat_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Two More 'Sexual Indoctrination' Bills Vetoed_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
U.S. Population Nears 300 Million_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
U.S.S. Liberty Crew Reunites_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
U.S. State Department - Israel Plagued by Trafficking_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ugly Lessons from Katrina_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Al Qaeda 'Cleric' Worked for Both Sides_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Birmingham Riots Result of Multicultural Experiment_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Black Gets Prison for al-Qaeda Plot_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - BNP Music Label Launched_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - BNP Picking Up Votes - Viewed as Persecuted Underdog_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - British National Party Chairman Nick Griffin Released_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Censorship by Multiracialists Raises Ugly Head_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Conservatives Fear Nationalist Competition_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - English Town Continues to Suffer From Multiracialism_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Keighley Protest Still On_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Muslims Scream About Ice Cream_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - National Demonstration Against Police Anti-White Racism Planned_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Nov. 2 Free Speech Demo Plan Forges Ahead_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Now It's Griffin_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Police Arrest Anti-White Goon_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Police Investigating Multiracialist Entertainer for Threatening Whites_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Popular Muslim Video Supports Violence Against Non-Believers_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Race Rioting Erupts in Birmingham_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Racial Justice Sunday Staged by Rapidly Shrinking Church_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Secret Police Seize Nationalist Paper_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Top Cop Urges Police To Wear Islamic Battle Colors_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - White Leaders Undaunted by Coordinated Violent Attacks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Whites Furious Over Removal of Memorial To Slain Teenager_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK - Whites Quitting Cities_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK = Church Anger at Islamic Texts_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK Cops Threaten Vet Over Flag_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UK journalist arrested in Israel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ukraine - David Duke Earns Doctorate in History_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ulster - Anti-White Loyalist Thug Slain_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ulster - Loyalists Join Jews in Human Smuggling Ring_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ulster - Religious Fanatics Say No To Catholics, Yes To Non-Whites_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ulster-Scots Culture Enjoys a Renaissance_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
UN Antislavery Day Celebrates Massacre of Whites_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Updated - Who Rules America_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
US - White Poverty Soars_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
US Evangelicals Increasingly Question Pro-Zionist Heresy_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
US Iraq Atrocities Nothing New_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
US Left - Tools of Oligarchs, Zionists, System_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
US Nationalists Record Song for BNP_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
US Provided KLA With Food_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
USS LIBERTY Memorial - AMERICAN LEADERS SUPPORT USS Liberty SURVIVORS_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
USS Liberty Veterans Present Pentagon With Report on Israeli War Crimes_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Usury Perfected_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Utahns Leaving Multiracial Public Schools_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
V-News.org Exclusive - The Plan De San Diego_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Vang Guilty in Hunter Massacre Trial_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Vang Says Three Hunters Deserved to Die_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Vanguard News Network » Blog Archive » Important Thoughts, Financial and Economic Advice_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Vanunu - Israel's Nuclear Arsenal a Threat to Middle East_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Venezuelan Chavez wants to be world's anti-U.S. voice_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Veteran Congressman Paul Findley Exposes Israel’s Lobby_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Vigilantes Attack Elderly Border Protestors_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Viroqua, WI School Board Bans 'Diversity Day'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Voice For Europe - Pan-European Co-ordination Against Turkish EU Membership_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Voices from the Past - Languages of Our Ancestors_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Voodoo Faithful on Annual Pilgrimage_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Voting for Pro-White Parties Is 'Spitting in God's Face'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Wal-Mart Turns in Student’s Anti-Bush Photo, Secret Service Investigates Him_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Waldorf MW I Manuals/ <Directory> <Directory> Oct 5 2015 1:52 AM
Wales - Win for 'Heretic'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
War Criminal at Bay_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
War Party Atrocity Porn_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
War Signals_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Was Columbus Greek_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
WAS THERE REALLY A HOLOCAUST_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Was WWII Worth It_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Watts Riots 40 Years On_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
We at The Scriptorium_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Welcome, TAA#3 readers - Background on our authors subjects_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Welcome News - Turks May 'Shun' EU Talks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Welcome to the Jungle - Superdome Tales_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Wendy Campbell - 2006-09-11 - Parallels between Nazism, Zionists striking_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
We The People_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What's in the New Orleans Water_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What's This About 'Peak Oil'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What's Your Diversity Quotient_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What About 'Affirmative Action' for US Media Ownership_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What Does Israel Want_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What is National Vanguard_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What is So Wrong With White People_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What Makes Palestinians Think They Can_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What Makes Western Culture Unique_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What will become of the ‘American Dream’_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
What Would War Look Like_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Wheat and Chaff_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
When Al Qaeda Was An Ally of 'the West'_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Which Way, Milwaukee_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White America starts winning_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White Children Experience Slavery at Summer Camp_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White Heritage Sites Threatened on Cyprus_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White India_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White Interests_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White People's Party Forms in Nevada_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White Science, Black Humor_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White Slavery Focus of New Book_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Whites Make Stand at Superdome_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Whites Organize in Namibia_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Whites Repulse Turks in Georgian Waters_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Whites Suffering in New Orleans_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White Teen Dragged from Bus, Beaten, and Robbed by Anti-White Gang Members_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
White Wire Newsblog » A History of Kwanza by Ann Coulter…and a Special Kwanza Jingle From the White Wire Staff_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Who Rules America_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Who We Sold the Serbs To_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Why Hitler Attacked Soviet Russia When He Did_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Why Islam Didn't Conquer the World_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Why Israel’s Campaign in Lebanon is Failing_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Why Scandinavia Tops U.N. Standard of Living Index_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
wiesenthal - fake holocaust_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Wisconsin - New Flood of Hmong Refugees Will Strain Already Tight Budgets_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Wisconsin - Rampage Killer, Friends Now Suspects in 2001 Homicide_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Witnesses - New Orleans Cops are Looters_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Worldwide Lack of Concern Over Israel's White Slave Trade_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
www.iraqthejewswar.com/ <Directory> <Directory> Oct 5 2015 1:52 AM
Ygg/ <Directory> <Directory> Oct 5 2015 1:52 AM
YGGDRASIL - Lesson Number One_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Youth Gang Rape Reported in Milwaukee_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Zimbabwe - Armed Police Stealing Farm Equipment_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Zimbabwe - Monkey Behind Famine_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Zionists Cheer Creep DeLay_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Zionist Shill's Mistake Endangers Family_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Zionists Show Contempt For Christians_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Zionists Slam Greeks_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Zionists Threaten Leader with Occult Ritual Murder_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
Zionist Televangelist Paid Hush Money in 'Gay' Scandal_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
zogencryption_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
‘Patriotism’ is the Last Refuge of the Scoundrel_files/ <Directory> <Directory> Oct 5 2015 1:52 AM
'Affirmative Action' Chief Latest 'Victim' of Katrina.htm HTML File 3 KB Oct 2 2012 12:31 AM
'Anti-Semitism' Center Set Up at Yale.htm HTML File 4.5 KB Oct 2 2012 12:30 AM
'Border Baby' Boom Strains South Texas.htm HTML File 4.6 KB Oct 2 2012 12:28 AM
'Down Low' Lifestyle Causing AIDS Epidemic Among Blacks.htm HTML File 6.6 KB Oct 2 2012 12:33 AM
'Down Low' Lifestyle Suspected in Porn Industry HIV Scare.htm HTML File 3.5 KB Oct 2 2012 12:33 AM
'Feldman' Attack on 'Passion' is a Hoax.htm HTML File 5.1 KB Oct 2 2012 12:27 AM
'Gay' Groups Fight Parents Over School's Mandatory Homosexual Indoctrination.htm HTML File 4.5 KB Oct 2 2012 12:29 AM
'Governator' Refuses Tookie Clemency.htm HTML File 24.1 KB Oct 2 2012 12:32 AM
'Hate crime' victims - Young, poor, white - 2006-02-22.txt Text File 4.3 KB Oct 2 2012 12:28 AM
'IQ' vs. Standardized Tests.htm HTML File 149.1 KB Oct 2 2012 12:27 AM
'I Was a Victim of Racial Violence in Junior High'.htm HTML File 7 KB Oct 2 2012 12:30 AM
'Madonna' - Diva of Degeneracy to Perform in Israel.htm HTML File 2.6 KB Oct 2 2012 12:31 AM
'Mighty Whitey' Defends Algiers Point.htm HTML File 4 KB Oct 2 2012 12:30 AM
'Mud Duck' - Vang Trial Hits Emotional Peak.htm HTML File 4.5 KB Oct 2 2012 12:30 AM
'Neutral' Official to KLA - 'Careful With Those Grenades'.htm HTML File 2.8 KB Oct 2 2012 12:34 AM
'Sugar daddies' fuelling HIV spread.htm HTML File 4.3 KB Oct 2 2012 12:32 AM
'The Jews are being pulled from their palaces, decapitated, and fed to the dogs'.htm HTML File 6.8 KB Oct 2 2012 12:33 AM
'Tolerance' Runs Out for Firm.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
'Voices of Heaven' Ordered Not to Sing Sacred Music.htm HTML File 2.6 KB Oct 2 2012 12:33 AM
0,,31580,00.html HTML File 1.2 KB Oct 2 2012 12:28 AM
2 standards for diversity in the legal fraternity.htm HTML File 5 KB Oct 2 2012 12:28 AM
2_On_Being_White.PDF PDF Document 275.9 KB Oct 2 2012 12:31 AM
6millionmyth.pdf PDF Document 181.8 KB Oct 2 2012 12:28 AM
6millionmyth.rtf RTF File 214.9 KB Oct 2 2012 12:28 AM
9-11 Families Demand Action on Immigration.htm HTML File 3 KB Oct 2 2012 12:30 AM
13tribe.pdf PDF Document 445.6 KB Oct 2 2012 12:32 AM
13tribe.rtf RTF File 1.8 MB Oct 2 2012 12:28 AM
15,000 Hmong Head for Minnesota.htm HTML File 2.8 KB Oct 2 2012 12:31 AM
16.3allen.pdf.htm HTML File 8.2 KB Oct 2 2012 12:28 AM
16CrucifiedSaviors.pdf PDF Document 1.5 MB Oct 2 2012 12:31 AM
36-ferrocement-water-tanks.pdf PDF Document 203.2 KB Oct 2 2012 12:34 AM
50 Cent Gives New Meaning to 'Da Bomb'.htm HTML File 2.9 KB Oct 2 2012 12:32 AM
53-francis.pdf PDF Document 177.4 KB Oct 2 2012 12:34 AM
53-km-slezkine.pdf PDF Document 273 KB Oct 2 2012 12:34 AM
53-wch-script.pdf PDF Document 265.2 KB Oct 2 2012 12:32 AM
66QnA.pdf PDF Document 48 KB Oct 2 2012 12:32 AM
72.3bentley.pdf.htm HTML File 7.1 KB Oct 2 2012 12:28 AM
80 BC - The White World’s Oldest Computer.htm HTML File 4.5 KB Oct 2 2012 12:33 AM
88Precepts.pdf PDF Document 20.5 KB Oct 2 2012 12:31 AM
88Precepts.rtf RTF File 36.6 KB Oct 2 2012 12:31 AM
90December.pdf PDF Document 420.7 KB Oct 2 2012 12:30 AM
90November.pdf PDF Document 306 KB Oct 2 2012 12:30 AM
91April.pdf PDF Document 485.3 KB Oct 2 2012 12:30 AM
91February.pdf PDF Document 334.1 KB Oct 2 2012 12:31 AM
91January.pdf PDF Document 345.9 KB Oct 2 2012 12:27 AM
91July.pdf PDF Document 416.7 KB Oct 2 2012 12:29 AM
91March.pdf PDF Document 358.9 KB Oct 2 2012 12:30 AM
94June.pdf PDF Document 587.9 KB Oct 2 2012 12:28 AM
95February.pdf PDF Document 450 KB Oct 2 2012 12:30 AM
95March.pdf PDF Document 515.1 KB Oct 2 2012 12:30 AM
96August.pdf PDF Document 632.8 KB Oct 2 2012 12:31 AM
96December.pdf PDF Document 514.2 KB Oct 2 2012 12:31 AM
96January.pdf PDF Document 441.5 KB Oct 2 2012 12:31 AM
96July.pdf PDF Document 629.8 KB Oct 2 2012 12:30 AM
96June.pdf PDF Document 554.3 KB Oct 2 2012 12:30 AM
96November.pdf PDF Document 487.2 KB Oct 2 2012 12:33 AM
96October.pdf PDF Document 746.1 KB Oct 2 2012 12:33 AM
96September.pdf PDF Document 494.2 KB Oct 2 2012 12:31 AM
97April.pdf PDF Document 455 KB Oct 2 2012 12:31 AM
97December.pdf PDF Document 495.1 KB Oct 2 2012 12:33 AM
97February.pdf PDF Document 440.6 KB Oct 2 2012 12:33 AM
97January.pdf PDF Document 462.3 KB Oct 2 2012 12:28 AM
97Jul-Aug.pdf PDF Document 980.7 KB Oct 2 2012 12:33 AM
97June.pdf PDF Document 458.2 KB Oct 2 2012 12:31 AM
97March.pdf PDF Document 477.8 KB Oct 2 2012 12:28 AM
97May.pdf PDF Document 585 KB Oct 2 2012 12:32 AM
97November.pdf PDF Document 557.5 KB Oct 2 2012 12:31 AM
97October.pdf PDF Document 493.6 KB Oct 2 2012 12:32 AM
97September(1).pdf PDF Document 501.5 KB Oct 2 2012 12:32 AM
97September.pdf PDF Document 501.5 KB Oct 2 2012 12:28 AM
98April.pdf PDF Document 558 KB Oct 2 2012 12:28 AM
98August.pdf PDF Document 541.6 KB Oct 2 2012 12:32 AM
98December.pdf PDF Document 845.4 KB Oct 2 2012 12:34 AM
98February.pdf PDF Document 641.5 KB Oct 2 2012 12:27 AM
98January.pdf PDF Document 488.9 KB Oct 2 2012 12:29 AM
98July.pdf PDF Document 548.3 KB Oct 2 2012 12:27 AM
98June.pdf PDF Document 337.8 KB Oct 2 2012 12:31 AM
98March(1).pdf PDF Document 513.6 KB Oct 2 2012 12:32 AM
98March.pdf PDF Document 513.6 KB Oct 2 2012 12:29 AM
98May.pdf PDF Document 426 KB Oct 2 2012 12:32 AM
98November.pdf PDF Document 1.2 MB Oct 2 2012 12:31 AM
98October.pdf PDF Document 687.2 KB Oct 2 2012 12:28 AM
98September.pdf PDF Document 619.8 KB Oct 2 2012 12:31 AM
99April.pdf PDF Document 316.4 KB Oct 2 2012 12:32 AM
99August.pdf PDF Document 262.1 KB Oct 2 2012 12:27 AM
99December.pdf PDF Document 415 KB Oct 2 2012 12:28 AM
99February.pdf PDF Document 295.6 KB Oct 2 2012 12:33 AM
99January.pdf PDF Document 360.8 KB Oct 2 2012 12:31 AM
99July.pdf PDF Document 320.6 KB Oct 2 2012 12:29 AM
99June.pdf PDF Document 284.5 KB Oct 2 2012 12:31 AM
99March.pdf PDF Document 282.8 KB Oct 2 2012 12:33 AM
99May.pdf PDF Document 270.1 KB Oct 2 2012 12:32 AM
99November.pdf PDF Document 329.7 KB Oct 2 2012 12:34 AM
99October.pdf PDF Document 270 KB Oct 2 2012 12:31 AM
99September.pdf PDF Document 271.5 KB Oct 2 2012 12:30 AM
100 Million Dead - JEWS AND COMMUNISM Part 1.htm HTML File 42.3 KB Oct 2 2012 12:28 AM
100 Million Dead - JEWS AND COMMUNISM Part 2.htm HTML File 41.3 KB Oct 2 2012 12:33 AM
100 Million Dead - JEWS AND COMMUNISM Part 3.htm HTML File 38.5 KB Oct 2 2012 12:28 AM
100ReasonsWereGladToBeMen.pdf PDF Document 6.5 KB Oct 2 2012 12:32 AM
100waystolivefree.pdf PDF Document 39.7 KB Oct 2 2012 12:31 AM
105HolocaustQuestions.pdf PDF Document 94.1 KB Oct 2 2012 12:30 AM
110.Eine_niedere_Form.pdf PDF Document 101.4 KB Oct 2 2012 12:33 AM
110.Geistige_Behinderung.pdf PDF Document 159.9 KB Oct 2 2012 12:32 AM
131Sample.pdf PDF Document 294.1 KB Oct 2 2012 12:30 AM
0208issue.html HTML File 158.6 KB Oct 2 2012 12:28 AM
0209issue.html HTML File 125.6 KB Oct 2 2012 12:28 AM
0210issue.html HTML File 145.3 KB Oct 2 2012 12:32 AM
0211issue.html HTML File 135.3 KB Oct 2 2012 12:28 AM
0212issue.html HTML File 136.7 KB Oct 2 2012 12:29 AM
260 million CHRISTIAN Lives Lost.htm HTML File 53.1 KB Oct 2 2012 12:31 AM
0301issue.html HTML File 147.6 KB Oct 2 2012 12:31 AM
0302issue.html HTML File 136.1 KB Oct 2 2012 12:34 AM
0303issue.html HTML File 143.1 KB Oct 2 2012 12:31 AM
0304issue.html HTML File 139.3 KB Oct 2 2012 12:32 AM
0305issue.html HTML File 142.7 KB Oct 2 2012 12:33 AM
0306issue.html HTML File 155.3 KB Oct 2 2012 12:30 AM
0307issue.html HTML File 155 KB Oct 2 2012 12:30 AM
0308issue.html HTML File 156.4 KB Oct 2 2012 12:33 AM
0309issue.html HTML File 147.5 KB Oct 2 2012 12:33 AM
0310issue.html HTML File 113.2 KB Oct 2 2012 12:32 AM
0311issue.html HTML File 150.6 KB Oct 2 2012 12:33 AM
0312issue.htm HTML File 137.1 KB Oct 2 2012 12:31 AM
365days.pdf PDF Document 13.6 MB Oct 2 2012 12:30 AM
0401issue.html HTML File 150 KB Oct 2 2012 12:31 AM
0402issue.html HTML File 147.3 KB Oct 2 2012 12:30 AM
0403issue.html HTML File 144.2 KB Oct 2 2012 12:30 AM
0404issue.html HTML File 154.2 KB Oct 2 2012 12:31 AM
0405issue.html HTML File 143.6 KB Oct 2 2012 12:30 AM
0406issue.html HTML File 151.1 KB Oct 2 2012 12:29 AM
0407issue.html HTML File 143.7 KB Oct 2 2012 12:27 AM
0408issue.html HTML File 147.6 KB Oct 2 2012 12:30 AM
0409issue.html HTML File 153.4 KB Oct 2 2012 12:28 AM
0410issue.html HTML File 153.1 KB Oct 2 2012 12:28 AM
0411issue.htm HTML File 147.7 KB Oct 2 2012 12:33 AM
0412issue.html HTML File 142.7 KB Oct 2 2012 12:32 AM
0506wiesendemo.pdf PDF Document 226.2 KB Oct 2 2012 12:29 AM
911issue.html HTML File 61 KB Oct 2 2012 12:32 AM
911report.pdf PDF Document 7.2 MB Oct 2 2012 12:28 AM
911report.rtf RTF File 14.6 MB Oct 2 2012 12:34 AM
912issue.html HTML File 59.2 KB Oct 2 2012 12:30 AM
913issue.html HTML File 59.9 KB Oct 2 2012 12:32 AM
914issue.html HTML File 57.1 KB Oct 2 2012 12:28 AM
915issue.html HTML File 61.5 KB Oct 2 2012 12:34 AM
916issue.html HTML File 66.4 KB Oct 2 2012 12:28 AM
921issue.html HTML File 75.8 KB Oct 2 2012 12:28 AM
922issue.html HTML File 63.7 KB Oct 2 2012 12:34 AM
923issue.html HTML File 65 KB Oct 2 2012 12:29 AM
924issue.html HTML File 61.3 KB Oct 2 2012 12:33 AM
925issue.html HTML File 64.1 KB Oct 2 2012 12:28 AM
926issue.html HTML File 74.1 KB Oct 2 2012 12:34 AM
927issue.html HTML File 60.8 KB Oct 2 2012 12:29 AM
928issue.html HTML File 62.7 KB Oct 2 2012 12:31 AM
931issue.html HTML File 63.6 KB Oct 2 2012 12:31 AM
932issue.html HTML File 59.3 KB Oct 2 2012 12:33 AM
933issue.html HTML File 60.5 KB Oct 2 2012 12:28 AM
934issue.html HTML File 62.1 KB Oct 2 2012 12:31 AM
935issue.html HTML File 62.3 KB Oct 2 2012 12:31 AM
936issue.html HTML File 60.6 KB Oct 2 2012 12:28 AM
937issue.html HTML File 60.7 KB Oct 2 2012 12:31 AM
938issue.html HTML File 61.1 KB Oct 2 2012 12:28 AM
939issue.html HTML File 119.7 KB Oct 2 2012 12:34 AM
941issue.html HTML File 63.6 KB Oct 2 2012 12:30 AM
942issue.html HTML File 57.5 KB Oct 2 2012 12:32 AM
943issue.html HTML File 59.3 KB Oct 2 2012 12:33 AM
944issue.html HTML File 56.9 KB Oct 2 2012 12:34 AM
945issue.html HTML File 58.7 KB Oct 2 2012 12:30 AM
946issue.html HTML File 56.8 KB Oct 2 2012 12:33 AM
947issue.html HTML File 64 KB Oct 2 2012 12:34 AM
948issue.html HTML File 70 KB Oct 2 2012 12:34 AM
949issue.html HTML File 71.7 KB Oct 2 2012 12:31 AM
951issue.html HTML File 78.4 KB Oct 2 2012 12:28 AM
952issue.html HTML File 82.6 KB Oct 2 2012 12:28 AM
953issue.html HTML File 80.5 KB Oct 2 2012 12:34 AM
954issue.html HTML File 75.8 KB Oct 2 2012 12:31 AM
955issue.html HTML File 78.2 KB Oct 2 2012 12:32 AM
956issue.html HTML File 76.3 KB Oct 2 2012 12:31 AM
957issue.html HTML File 80.3 KB Oct 2 2012 12:27 AM
958issue.html HTML File 79.5 KB Oct 2 2012 12:30 AM
959issue.html HTML File 80.9 KB Oct 2 2012 12:30 AM
961issue.html HTML File 81.4 KB Oct 2 2012 12:33 AM
962issue.html HTML File 82.4 KB Oct 2 2012 12:28 AM
963issue.html HTML File 77.7 KB Oct 2 2012 12:28 AM
964issue.html HTML File 78.3 KB Oct 2 2012 12:28 AM
965issue.html HTML File 75.7 KB Oct 2 2012 12:32 AM
966issue.html HTML File 70 KB Oct 2 2012 12:33 AM
967issue.html HTML File 79.4 KB Oct 2 2012 12:31 AM
968issue.html HTML File 73.7 KB Oct 2 2012 12:28 AM
969issue.html HTML File 77.5 KB Oct 2 2012 12:33 AM
971issue.html HTML File 83.3 KB Oct 2 2012 12:29 AM
972issue.html HTML File 81.1 KB Oct 2 2012 12:30 AM
973issue.html HTML File 92.1 KB Oct 2 2012 12:32 AM
974issue.html HTML File 79.7 KB Oct 2 2012 12:34 AM
975issue.html HTML File 77 KB Oct 2 2012 12:34 AM
976issue.html HTML File 87.7 KB Oct 2 2012 12:31 AM
979issue.html HTML File 84.7 KB Oct 2 2012 12:33 AM
981issue.html HTML File 89.1 KB Oct 2 2012 12:33 AM
982issue.html HTML File 93.9 KB Oct 2 2012 12:27 AM
983issue.html HTML File 84.6 KB Oct 2 2012 12:28 AM
984issue.html HTML File 82.2 KB Oct 2 2012 12:31 AM
985issue.html HTML File 78.4 KB Oct 2 2012 12:33 AM
986issue.html HTML File 77.2 KB Oct 2 2012 12:33 AM
987issue.html HTML File 82.1 KB Oct 2 2012 12:30 AM
988issue.html HTML File 76.2 KB Oct 2 2012 12:34 AM
989issue.html HTML File 77.8 KB Oct 2 2012 12:31 AM
991issue.html HTML File 119.4 KB Oct 2 2012 12:31 AM
992issue.html HTML File 111 KB Oct 2 2012 12:33 AM
993issue.html HTML File 118.3 KB Oct 2 2012 12:28 AM
994issue.html HTML File 111.1 KB Oct 2 2012 12:30 AM
995issue.html HTML File 76.8 KB Oct 2 2012 12:33 AM
996issue.html HTML File 85.3 KB Oct 2 2012 12:31 AM
997issue.html HTML File 102.9 KB Oct 2 2012 12:28 AM
998issue.html HTML File 85 KB Oct 2 2012 12:31 AM
999issue.html HTML File 111.2 KB Oct 2 2012 12:28 AM
1984.pdf PDF Document 564.4 KB Oct 2 2012 12:28 AM
1984.rtf RTF File 712.5 KB Oct 2 2012 12:33 AM
1984.zip ZIP Archive 367.4 KB Oct 2 2012 12:33 AM
2005-12-07 - Wanted - More Race Realism, Less Moralistic.htm HTML File 44.9 KB Oct 2 2012 12:28 AM
2005-12-07 - wanted_more_race_realism_less.php.htm HTML File 362.8 KB Oct 2 2012 12:28 AM
5700IsraelAid.pdf PDF Document 138.8 KB Oct 2 2012 12:33 AM
9011issue.html HTML File 60.4 KB Oct 2 2012 12:31 AM
9012issue.html HTML File 60.5 KB Oct 2 2012 12:30 AM
9107issue.html HTML File 60.5 KB Oct 2 2012 12:33 AM
9108issue.html HTML File 64.1 KB Oct 2 2012 12:34 AM
9109issue.html HTML File 56 KB Oct 2 2012 12:33 AM
9110issue.html HTML File 67.2 KB Oct 2 2012 12:33 AM
9111issue.html HTML File 58.1 KB Oct 2 2012 12:33 AM
9112issue.html HTML File 62.5 KB Oct 2 2012 12:33 AM
9209issue.html HTML File 62.1 KB Oct 2 2012 12:28 AM
9210issue.html HTML File 65 KB Oct 2 2012 12:33 AM
9211issue.html HTML File 62 KB Oct 2 2012 12:33 AM
9212issue.html HTML File 62.9 KB Oct 2 2012 12:30 AM
9311issue.html HTML File 60.5 KB Oct 2 2012 12:27 AM
9312issue.html HTML File 58.7 KB Oct 2 2012 12:34 AM
9410issue.html HTML File 61.5 KB Oct 2 2012 12:29 AM
9411issue.html HTML File 65.6 KB Oct 2 2012 12:30 AM
9412issue.html HTML File 74.2 KB Oct 2 2012 12:29 AM
9501ar.pdf PDF Document 434.4 KB Oct 2 2012 12:33 AM
9510issue.html HTML File 79.5 KB Oct 2 2012 12:32 AM
9511issue.html HTML File 80.7 KB Oct 2 2012 12:31 AM
9512issue.html HTML File 76.6 KB Oct 2 2012 12:33 AM
9610issue.html HTML File 74.1 KB Oct 2 2012 12:32 AM
9611issue.html HTML File 78.7 KB Oct 2 2012 12:32 AM
9612issue.html HTML File 80.1 KB Oct 2 2012 12:32 AM
9710issue.html HTML File 81.6 KB Oct 2 2012 12:32 AM
9711issue.html HTML File 80.8 KB Oct 2 2012 12:32 AM
9712issue.html HTML File 104.5 KB Oct 2 2012 12:31 AM
9778issue.html HTML File 172.9 KB Oct 2 2012 12:28 AM
9810issue.html HTML File 75 KB Oct 2 2012 12:30 AM
9811issue.html HTML File 73.8 KB Oct 2 2012 12:32 AM
9812issue.html HTML File 74.5 KB Oct 2 2012 12:27 AM
9910issue.html HTML File 77.4 KB Oct 2 2012 12:32 AM
9911issue.html HTML File 79.9 KB Oct 2 2012 12:29 AM
9912issue.html HTML File 100.2 KB Oct 2 2012 12:34 AM
41839.web.pdf PDF Document 11 KB Oct 2 2012 12:32 AM
45777355.html HTML File 30.9 KB Oct 2 2012 12:28 AM
Abandoned and Betrayed.htm HTML File 5.3 KB Oct 2 2012 12:30 AM
Abandoned Gold Standard Guarantees Inflation.htm HTML File 15.1 KB Oct 2 2012 12:31 AM
ABC Targets White Children.htm HTML File 7.6 KB Oct 2 2012 12:29 AM
about - THE CHURCH OF TRUE ISRAEL.html HTML File 6.8 KB Oct 2 2012 12:34 AM
Accused Negro Sniper to 'Question' His White Victim.htm HTML File 1.8 KB Oct 2 2012 12:31 AM
ACLU Top Heavy with Jews.htm HTML File 6.8 KB Oct 2 2012 12:27 AM
adaptanddie.pdf PDF Document 365.1 KB Oct 2 2012 12:31 AM
adaptanddie.rtf RTF File 186.3 KB Oct 2 2012 12:28 AM
A Date with Bevin.htm HTML File 4.1 KB Oct 2 2012 12:28 AM
ADL's Foxman - New Testament is Anti-Semitic.htm HTML File 2.4 KB Oct 2 2012 12:28 AM
ADL Anti-Defamation League of B'nai B'rith conducts smear campaigns - ADL Anti-Defamation League of B'nai B'rith is caught in cover-up of its crimes.htm HTML File 57.5 KB Oct 2 2012 12:34 AM
ADL Briefs U.S. House on Internet 'Hate'.htm HTML File 3.5 KB Oct 2 2012 12:33 AM
ADL Champions Gay Marriage, Calls Opponents 'Ugly Bigots'.htm HTML File 2.7 KB Oct 2 2012 12:31 AM
ADL Demands Gulag for Dissenters.htm HTML File 3.5 KB Oct 2 2012 12:34 AM
adlfactsheet1.pdf PDF Document 188.6 KB Oct 2 2012 12:27 AM
ADL Führer Warns of 'Intermarriage' and Public Schooling.htm HTML File 5.5 KB Oct 2 2012 12:28 AM
ADL Opponents Officially Designated As 'Terrorist Organizations'.htm HTML File 6.5 KB Oct 2 2012 12:27 AM
Adorno's Bastards and the Frankfurt School.htm HTML File 53.2 KB Oct 2 2012 12:32 AM
Ads Declare Population Driven Environmental Crisis In California.htm HTML File 4.2 KB Oct 2 2012 12:30 AM
adv-music.html HTML File 2.7 KB Oct 2 2012 12:34 AM
adv-tapes.html HTML File 9.1 KB Oct 2 2012 12:33 AM
adv010194.html HTML File 21.7 KB Oct 2 2012 12:29 AM
adv010894.html HTML File 16.9 KB Oct 2 2012 12:29 AM
adv011594.html HTML File 17.5 KB Oct 2 2012 12:33 AM
adv012994.html HTML File 21.2 KB Oct 2 2012 12:28 AM
adv020594.html HTML File 18.1 KB Oct 2 2012 12:31 AM
adv021994.html HTML File 19.9 KB Oct 2 2012 12:33 AM
adv022093.html HTML File 19.3 KB Oct 2 2012 12:31 AM
adv022496.html HTML File 15.3 KB Oct 2 2012 12:31 AM
adv022793.html HTML File 17.8 KB Oct 2 2012 12:34 AM
adv030594.html HTML File 19.9 KB Oct 2 2012 12:30 AM
adv031294.html HTML File 20.1 KB Oct 2 2012 12:30 AM
adv031393.html HTML File 19.3 KB Oct 2 2012 12:28 AM
adv031994.html HTML File 22.3 KB Oct 2 2012 12:31 AM
adv032093.html HTML File 17.4 KB Oct 2 2012 12:32 AM
adv040293.html HTML File 18.3 KB Oct 2 2012 12:28 AM
adv040393.html HTML File 6 KB Oct 2 2012 12:33 AM
adv041093.html HTML File 15.9 KB Oct 2 2012 12:27 AM
adv042493.html HTML File 18.9 KB Oct 2 2012 12:31 AM
adv043094.html HTML File 17.4 KB Oct 2 2012 12:28 AM
adv050193.html HTML File 19.9 KB Oct 2 2012 12:29 AM
adv050794.html HTML File 18.2 KB Oct 2 2012 12:28 AM
adv052993.html HTML File 18.7 KB Oct 2 2012 12:30 AM
adv060593.html HTML File 19.7 KB Oct 2 2012 12:28 AM
adv061293.html HTML File 21.6 KB Oct 2 2012 12:28 AM
adv061993.html HTML File 20.7 KB Oct 2 2012 12:30 AM
adv071093a.html HTML File 17.8 KB Oct 2 2012 12:28 AM
adv071093b.html HTML File 20.4 KB Oct 2 2012 12:30 AM
adv072493.html HTML File 20.3 KB Oct 2 2012 12:28 AM
adv080793.html HTML File 21.4 KB Oct 2 2012 12:29 AM
adv081493.html HTML File 20.4 KB Oct 2 2012 12:34 AM
adv082193.html HTML File 20.3 KB Oct 2 2012 12:30 AM
adv082893.html HTML File 19.9 KB Oct 2 2012 12:33 AM
adv091193.html HTML File 19.1 KB Oct 2 2012 12:34 AM
adv091893.html HTML File 16.5 KB Oct 2 2012 12:31 AM
adv092593.html HTML File 18.7 KB Oct 2 2012 12:33 AM
adv10-15-05.pdf PDF Document 296 KB Oct 2 2012 12:33 AM
adv100293.html HTML File 19.7 KB Oct 2 2012 12:33 AM
adv100792.html HTML File 19.3 KB Oct 2 2012 12:32 AM
adv101594.html HTML File 60.8 KB Oct 2 2012 12:30 AM
adv102393.html HTML File 20.1 KB Oct 2 2012 12:30 AM
adv103093.html HTML File 17.2 KB Oct 2 2012 12:31 AM
adv110693.html HTML File 17.6 KB Oct 2 2012 12:31 AM
adv111393.html HTML File 18.1 KB Oct 2 2012 12:27 AM
adv120493.html HTML File 17.9 KB Oct 2 2012 12:33 AM
adv122593.html HTML File 19.9 KB Oct 2 2012 12:30 AM
Advice on building an electric car for those interested.htm HTML File 96 KB Oct 2 2012 12:31 AM
aet.pdf PDF Document 1.5 MB Oct 2 2012 12:33 AM
Africa In Our Midst - Lessons From Katrina.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
African 'Culture' Spreads HIV.htm HTML File 3.4 KB Oct 2 2012 12:32 AM
After Millennia in India, Lost Tribe Returns to Israel.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
after_apartheid.pdf PDF Document 770.4 KB Oct 2 2012 12:28 AM
agapintestscoresbecomesatalkingpoint.html HTML File 7.5 KB Oct 2 2012 12:33 AM
AgentProvocateur.pdf PDF Document 6.8 KB Oct 2 2012 12:33 AM
Agitprop.htm HTML File 4.8 KB Oct 2 2012 12:31 AM
A Great Day in L.A..htm HTML File 9.5 KB Oct 2 2012 12:31 AM
A Group of Friends - Magnet For A Lonely America.htm HTML File 6.8 KB Oct 2 2012 12:33 AM
aids.pdf PDF Document 260.9 KB Oct 2 2012 12:34 AM
AIDS Alert! Avoid Sugar Daddies!.htm HTML File 2.3 KB Oct 2 2012 12:33 AM
AIDS Epidemic Among Black Elite.htm HTML File 3.2 KB Oct 2 2012 12:33 AM
aidsworkersbattlemythandignorance.html HTML File 6.5 KB Oct 2 2012 12:27 AM
aidtoisrael.pdf PDF Document 96.2 KB Oct 2 2012 12:34 AM
AIPAC, the Religious Right and American Foreign Policy.htm HTML File 33.8 KB Oct 2 2012 12:28 AM
AIPAC Congratulates Itself on the Slaughter in Lebanon.htm HTML File 3.1 KB Oct 2 2012 12:33 AM
AIPAC Espionage Case Dismissal Gambit Fails.htm HTML File 3.6 KB Oct 2 2012 12:31 AM
AIPAC Scandal Breaks Loose.htm HTML File 2.6 KB Oct 2 2012 12:29 AM
AIPAC Warns Dems Not to Appear at Anti-war Demo.htm HTML File 2.8 KB Oct 2 2012 12:30 AM
airport_flier_1.pdf PDF Document 238.6 KB Oct 2 2012 12:33 AM
Alabama - Immigrants Make School Rolls Larger than Town.htm HTML File 3.1 KB Oct 2 2012 12:33 AM
Alan Stang - 2004-01-16 - 'Martin Luther' King - Communist Fraud.htm HTML File 26.6 KB Oct 2 2012 12:28 AM
Ali G Worries ADL.htm HTML File 2.6 KB Oct 2 2012 12:33 AM
Alleged Racial-Beating Victim Admits Concocting Story.htm HTML File 3.9 KB Oct 2 2012 12:29 AM
allies.pdf PDF Document 592.7 KB Oct 2 2012 12:33 AM
A Look Back at Revisionism.htm HTML File 116 KB Oct 2 2012 12:27 AM
Alpin MacLaren - 2006-01-06 - Cold Turkey - Multiracialism is destroying our schools.htm HTML File 21.8 KB Oct 2 2012 12:27 AM
Alpin MacLaren - 2006-02-09 - Civil Wrongs.htm HTML File 21.6 KB Oct 2 2012 12:31 AM
Alpin MacLaren - 2006-03-02 - When Logic Fails.htm HTML File 8.9 KB Oct 2 2012 12:31 AM
A Man Named Arkan.htm HTML File 8.8 KB Oct 2 2012 12:30 AM
AMAZING ISSUE WITH TARGET.TXT Text File 1.9 KB Oct 2 2012 12:28 AM
America's Middle Class Shrinking in Globalist Economy.htm HTML File 2.8 KB Oct 2 2012 12:31 AM
America's Most Powerful Hate Group.htm HTML File 14.3 KB Oct 2 2012 12:31 AM
America Disappearing.htm HTML File 3.2 KB Oct 2 2012 12:28 AM
America Firster Jew Exposes Israel and the Zionist Network.htm HTML File 87.4 KB Oct 2 2012 12:34 AM
American Literature Sequence.pdf PDF Document 481.6 KB Oct 2 2012 12:28 AM
Americans Say Enough is Enough! Miller Beer Boycott Update.htm HTML File 10.1 KB Oct 2 2012 12:28 AM
american_haters2.pdf PDF Document 704.2 KB Oct 2 2012 12:34 AM
Amerika Text Uploads.sit SIT Archive 488.7 KB Oct 2 2012 12:33 AM
Amid Katrina Chaos, Congressman Used National Guard to Visit Home.htm HTML File 3.2 KB Oct 2 2012 12:33 AM
A Mile Too Far.htm HTML File 26.5 KB Oct 2 2012 12:33 AM
A Minuteman Boosts Border Overhaul Reform.htm HTML File 4.7 KB Oct 2 2012 12:30 AM
amusing_bible.zip ZIP Archive 365.3 KB Oct 2 2012 12:33 AM
amusing_gospel.zip ZIP Archive 341.2 KB Oct 2 2012 12:34 AM
Anarcho-Tyranny—Where Multiculturalism Leads.htm HTML File 7 KB Oct 2 2012 12:29 AM
A National Emergency.htm HTML File 2.4 KB Oct 2 2012 12:28 AM
Andrew Young Pulls a 'Mel Gibson'.htm HTML File 4.6 KB Oct 2 2012 12:32 AM
A New Commission for a New Era.htm HTML File 2.9 KB Oct 2 2012 12:32 AM
AnimalFarm.pdf PDF Document 224.6 KB Oct 2 2012 12:30 AM
AnneFrankFraud.pdf PDF Document 111.4 KB Oct 2 2012 12:31 AM
Another Anti-White Race-Hate Murder Ignored by National Media.htm HTML File 6.2 KB Oct 2 2012 12:28 AM
Anti-Child-Molester Protest Stopped by 'Anti-Fascist Action'.htm HTML File 3 KB Oct 2 2012 12:27 AM
Anti-White Discrimination Plagues European Art Scene.htm HTML File 2.9 KB Oct 2 2012 12:33 AM
Anti-White Hate Crimes.rtf RTF File 18.1 KB Oct 2 2012 12:30 AM
Anti-White Quotes.txt Text File 12.1 KB Oct 2 2012 12:28 AM
antichrist.htm HTML File 198 KB Oct 2 2012 12:33 AM
AntiHumans.pdf PDF Document 599.7 KB Oct 2 2012 12:31 AM
antiracism.htm HTML File 47.7 KB Oct 2 2012 12:33 AM
antisemitismcauses.pdf PDF Document 990.6 KB Oct 2 2012 12:29 AM
antisemitismcauses.rtf RTF File 547.7 KB Oct 2 2012 12:34 AM
A Once Great Britain.htm HTML File 7.2 KB Oct 2 2012 12:30 AM
AP.pdf PDF Document 201.3 KB Oct 2 2012 12:29 AM
AP.rtf RTF File 246.9 KB Oct 2 2012 12:31 AM
Apartheid State of Israel Expands Colonization of Golan Heights.htm HTML File 3.9 KB Oct 2 2012 12:27 AM
AP In Hurricane 'Moral Equivalency' Hassle.htm HTML File 4.9 KB Oct 2 2012 12:28 AM
AP Interviews Geert Wilders.htm HTML File 3.2 KB Oct 2 2012 12:33 AM
Apocalypse at Dresden - The Worst Massacre in the History of the World.htm HTML File 38.9 KB Oct 2 2012 12:32 AM
apology.htm HTML File 14.2 KB Oct 2 2012 12:28 AM
Apparent Drug Overdose Claims Life of National Vanguard Foe.htm HTML File 3.4 KB Oct 2 2012 12:34 AM
application.pdf PDF Document 396 KB Oct 2 2012 12:31 AM
Apr01.pdf PDF Document 1.1 MB Oct 2 2012 12:33 AM
Apr02.pdf PDF Document 1.4 MB Oct 2 2012 12:28 AM
Apr03.pdf PDF Document 1 MB Oct 2 2012 12:29 AM
Apr04.pdf PDF Document 1.2 MB Oct 2 2012 12:32 AM
Apr05-1.pdf PDF Document 636.9 KB Oct 2 2012 12:33 AM
April 30, 1863 - The Battle of Camarón.htm HTML File 8.9 KB Oct 2 2012 12:31 AM
Ar-fly.pdf PDF Document 114.3 KB Oct 2 2012 12:34 AM
AR2006041001423_pf.html HTML File 11.7 KB Oct 2 2012 12:33 AM
AR2006041200149.html HTML File 67.1 KB Oct 2 2012 12:31 AM
AR2006041200477.html HTML File 71.6 KB Oct 2 2012 12:33 AM
Arabs and Slave Trade.htm HTML File 11.5 KB Oct 2 2012 12:28 AM
arabtransfer.pdf PDF Document 2.1 MB Oct 2 2012 12:30 AM
arabtransfer.rtf RTF File 1.6 MB Oct 2 2012 12:31 AM
AreJewsARace.pdf PDF Document 463.8 KB Oct 2 2012 12:31 AM
A review of La convergence des catastrophes by Guillaume Corvus.htm HTML File 46.7 KB Oct 2 2012 12:30 AM
areyouawhiteman.pdf PDF Document 62.4 KB Oct 2 2012 12:33 AM
Arm Against 'Katricians,' Gun Dealers Tell Houston.htm HTML File 53.3 KB Oct 2 2012 12:31 AM
ArmingAmericaFraud.pdf PDF Document 27.5 KB Oct 2 2012 12:27 AM
Artful Anecdotes.htm HTML File 7.1 KB Oct 2 2012 12:28 AM
article7545.htm HTML File 14 KB Oct 2 2012 12:33 AM
asgard-pdf.zip ZIP Archive 822.6 KB Oct 2 2012 12:32 AM
Asians Murder British Lad for Being White.htm HTML File 2.9 KB Oct 2 2012 12:28 AM
A Split In the Racist Right.htm HTML File 21.4 KB Oct 2 2012 12:32 AM
Assassination Attempt on David Duke.htm HTML File 4.6 KB Oct 2 2012 12:29 AM
Assault Arrest Followed Word to Cheney.htm HTML File 2.8 KB Oct 2 2012 12:33 AM
A theory of Einstein the irrational plagiarist.htm HTML File 40.4 KB Oct 2 2012 12:31 AM
At Least 5 Killed By Police In New Orleans (Bad Guys Killed-Not Contractors).htm HTML File 63.1 KB Oct 2 2012 12:31 AM
audio.html HTML File 57.6 KB Oct 2 2012 12:30 AM
audiovideo2.htm HTML File 32.6 KB Oct 2 2012 12:29 AM
Aug01.pdf PDF Document 655.8 KB Oct 2 2012 12:28 AM
Aug02.pdf PDF Document 1.7 MB Oct 2 2012 12:30 AM
Aug03.pdf PDF Document 611.7 KB Oct 2 2012 12:31 AM
Aug04.pdf PDF Document 671.5 KB Oct 2 2012 12:31 AM
August 23, 1917 - Black Mutiny Leaves 16 Whites Dead.htm HTML File 5.4 KB Oct 2 2012 12:27 AM
auschwitzbunkers.pdf PDF Document 6.2 MB Oct 2 2012 12:33 AM
auschwitzplainfacts.pdf PDF Document 1.5 MB Oct 2 2012 12:29 AM
auschwitzplainfacts.rtf RTF File 2.1 MB Oct 2 2012 12:33 AM
AussieNationalism.pdf PDF Document 1.1 MB Oct 2 2012 12:31 AM
Australia - Rape Gangs and Multiracialism.htm HTML File 11.3 KB Oct 2 2012 12:33 AM
Austrian court confirms British historian guilty of Holocaust denial.htm HTML File 4.8 KB Oct 2 2012 12:33 AM
Austrians Fed Up With Kosher Arnie.htm HTML File 4.4 KB Oct 2 2012 12:32 AM
Autumnal Equinox Comes.htm HTML File 4.2 KB Oct 2 2012 12:33 AM
A V-Reader Gives Belgians a Message.htm HTML File 3.7 KB Oct 2 2012 12:28 AM
av.html HTML File 56.5 KB Oct 2 2012 12:27 AM
AvoidAIDS.pdf PDF Document 260.9 KB Oct 2 2012 12:28 AM
Avoid Mestizos - AIDS Rampant Among Mestizos.htm HTML File 2 KB Oct 2 2012 12:33 AM
A White College Student's Guide to Political Activism.htm HTML File 29.6 KB Oct 2 2012 12:27 AM
A White Future is Coming - an interview with Bob Whitaker.htm HTML File 26.5 KB Oct 2 2012 12:30 AM
A White Majority For New Orleans.htm HTML File 4 KB Oct 2 2012 12:31 AM
awmso.rtf RTF File 568.4 KB Oct 2 2012 12:33 AM
awmso.zip ZIP Archive 453.9 KB Oct 2 2012 12:32 AM
Axe Wielding Albanian Mob Brutally Assaults Elderly Serb Couple in Kosovo.htm HTML File 2.8 KB Oct 2 2012 12:30 AM
Aztecs Butchered, Ate Prisoners.htm HTML File 3.5 KB Oct 2 2012 12:27 AM
B&H Field Manual.pdf PDF Document 301.1 KB Oct 2 2012 12:31 AM
Background on the Jewish Defense Organization.htm HTML File 2.9 KB Oct 2 2012 12:33 AM
Back to...Homeschool.htm HTML File 3.1 KB Oct 2 2012 12:27 AM
Ban-Crazy Brits Nix St. George Again.htm HTML File 3.1 KB Oct 2 2012 12:33 AM
baraktriestoresolveplanedispute.html HTML File 5.8 KB Oct 2 2012 12:33 AM
barriers.pdf PDF Document 245.7 KB Oct 2 2012 12:34 AM
Baton Rouge Whites Mob Gun Stores.htm HTML File 5.1 KB Oct 2 2012 12:32 AM
BBC To Report On London Kabbalah Center.htm HTML File 13.1 KB Oct 2 2012 12:30 AM
BeastAsSaint.pdf PDF Document 135.8 KB Oct 2 2012 12:30 AM
BeastAsSaintNew.pdf PDF Document 76.8 KB Oct 2 2012 12:33 AM
Beauty, Art, and Race.htm HTML File 20.1 KB Oct 2 2012 12:31 AM
Behind the Mask of Respectability - The truth about the Anti-Defamation League of B'nai B'rith.htm HTML File 14.3 KB Oct 2 2012 12:29 AM
Belgian Police Raid Revisionists.htm HTML File 3.3 KB Oct 2 2012 12:30 AM
Belgium - Multicultural Fascism Now Official Policy.htm HTML File 6.4 KB Oct 2 2012 12:29 AM
Beloved Wagnerian Soprano Passes.htm HTML File 3.6 KB Oct 2 2012 12:34 AM
belzec.pdf PDF Document 3 MB Oct 2 2012 12:28 AM
Benedict Meets with Dissident Journalist.htm HTML File 3.3 KB Oct 2 2012 12:31 AM
Benedict to Meet with Traditionalists.htm HTML File 4.4 KB Oct 2 2012 12:28 AM
bengurionscandals.pdf PDF Document 513.6 KB Oct 2 2012 12:31 AM
bengurionscandals.rtf RTF File 680.9 KB Oct 2 2012 12:32 AM
Bergen's Lie.htm HTML File 3 KB Oct 2 2012 12:33 AM
beria.pdf PDF Document 318.4 KB Oct 2 2012 12:28 AM
Between the Jews and the Gentiles -- In the Aggadah, the Kabbalah, and in Jewish Thought.htm HTML File 61.1 KB Oct 2 2012 12:33 AM
Bevier Pamphlet JR.pdf PDF Document 207.9 KB Oct 2 2012 12:31 AM
Bevier_pamphlet.doc Microsoft Word Document 176.5 KB Oct 2 2012 12:32 AM
Beyonce - 'I Make Black Records'.htm HTML File 2.7 KB Oct 2 2012 12:32 AM
Beyond Chutzpah.htm HTML File 32.3 KB Oct 2 2012 12:33 AM
BibleTalmudQuotes.pdf PDF Document 106.6 KB Oct 2 2012 12:33 AM
biblography.html HTML File 8.2 KB Oct 2 2012 12:28 AM
Bill White - 2006-03-27 - National Socialism And The Klan.txt Text File 18.6 KB Oct 2 2012 12:33 AM
binLadenInterview.pdf PDF Document 79.4 KB Oct 2 2012 12:27 AM
biohazard.pdf PDF Document 284.7 KB Oct 2 2012 12:33 AM
biologicaljew.pdf PDF Document 244.9 KB Oct 2 2012 12:31 AM
biologicaljew.rtf RTF File 324.7 KB Oct 2 2012 12:33 AM
Birmingham Riots - Color is Only Skin Deep.htm HTML File 4 KB Oct 2 2012 12:31 AM
bks.bin BIN File 10.3 KB Oct 2 2012 12:29 AM
Black 'Jews' Accused in Israeli Welfare Scam.htm HTML File 6.3 KB Oct 2 2012 12:29 AM
blackamericaatwar.html HTML File 3.5 KB Oct 2 2012 12:32 AM
blackboxvoting.pdf PDF Document 971.7 KB Oct 2 2012 12:28 AM
Black Columnis - National Alliance Put Issue of Interracial Sex 'Out There'.htm HTML File 1.7 KB Oct 2 2012 12:31 AM
blackcrime.pdf PDF Document 408.8 KB Oct 2 2012 12:32 AM
Black Ex-Crack Salesman to Launch 'Books'.htm HTML File 4.5 KB Oct 2 2012 12:33 AM
Black God Begs Devil for Dignified Demise.htm HTML File 5.8 KB Oct 2 2012 12:31 AM
Black HUD Chief Foresees a 'Whiter' New Orleans.htm HTML File 4 KB Oct 2 2012 12:29 AM
BlackInnovation.pdf PDF Document 15.3 KB Oct 2 2012 12:27 AM
Black Leaders and the Demise of the OIC.htm HTML File 15.1 KB Oct 2 2012 12:30 AM
Black Muslim Update - Oakland Store Arab Kidnapped.htm HTML File 5.6 KB Oct 2 2012 12:32 AM
Blackness Tells It Like It Be.htm HTML File 5 KB Oct 2 2012 12:28 AM
Black Panther Foundation Seeks to Sell 'Burn Baby Burn' Hot Sauce.htm HTML File 2.3 KB Oct 2 2012 12:32 AM
Black Panthers Jailed in Cop-Killing Probe.htm HTML File 2.9 KB Oct 2 2012 12:34 AM
blackpupilslagdespiteeconomicstatus.html HTML File 6.6 KB Oct 2 2012 12:28 AM
blackpupilslosingoutindrivetoraisestandards.html HTML File 3.1 KB Oct 2 2012 12:31 AM
Black Rap Star Caught Using Sweat Shop Slaves.htm HTML File 1.7 KB Oct 2 2012 12:31 AM
Black Refugee Accused of Raping Retarded Girl.htm HTML File 3.4 KB Oct 2 2012 12:30 AM
blackscanthackcollegeegalitariansbaffled.html HTML File 12.8 KB Oct 2 2012 12:31 AM
blackscommit90percentofinterracialcrime.html HTML File 10 KB Oct 2 2012 12:30 AM
BlackSlaveOwners.pdf PDF Document 22 KB Oct 2 2012 12:31 AM
BlackSlaveOwners.rtf RTF File 33.4 KB Oct 2 2012 12:31 AM
Blacks on New Orleans Looting Rampage.htm HTML File 5.3 KB Oct 2 2012 12:28 AM
Black Supremacist Relies on White Science to Stay Alive.htm HTML File 3.5 KB Oct 2 2012 12:32 AM
blackswontgofarinparalleluniverse.html HTML File 4.2 KB Oct 2 2012 12:31 AM
Black US Employees Accused of Slave-driving in Africa.htm HTML File 3.8 KB Oct 2 2012 12:33 AM
Black Vikings Fumble 'Ethics'.htm HTML File 7.4 KB Oct 2 2012 12:32 AM
blackyouthcultureblamedaspupilsfail.html HTML File 5.8 KB Oct 2 2012 12:28 AM
black_history_month_1.pdf PDF Document 731.4 KB Oct 2 2012 12:31 AM
blfs-book-6.1.pdf PDF Document 3.2 MB Oct 2 2012 12:30 AM
Bloggers_Handbook2.pdf PDF Document 3.5 MB Oct 2 2012 12:28 AM
Blood on the Frost - Never Forget the Hmong Massacre.htm HTML File 23.3 KB Oct 2 2012 12:30 AM
BNP's Griffin - Asians Engage in Ethnic Cleansing in Oldham.htm HTML File 3.7 KB Oct 2 2012 12:28 AM
BNP Gets Voice on Yorkshire Race Council.htm HTML File 4.9 KB Oct 2 2012 12:30 AM
BNP Leader Affirms - Islam 'Wicked' Faith.htm HTML File 4.5 KB Oct 2 2012 12:31 AM
bolshevism.jpg JPEG Image 17.8 KB Oct 2 2012 12:27 AM
Bombs and Hurricanes - Our Struggle.htm HTML File 3.7 KB Oct 2 2012 12:31 AM
books-immigration.html HTML File 184 KB Oct 2 2012 12:28 AM
book_of_dead.zip ZIP Archive 1.1 MB Oct 2 2012 12:33 AM
boredoftherings.pdf PDF Document 230.4 KB Oct 2 2012 12:31 AM
boredoftherings.rtf RTF File 332.4 KB Oct 2 2012 12:31 AM
born_to_kill.jpg JPEG Image 13.1 KB Oct 2 2012 12:31 AM
Boycott Miller for Supporting Illegal Aliens and Illegal Immigration.htm HTML File 4.1 KB Oct 2 2012 12:32 AM
boycott_hd.pdf PDF Document 860.7 KB Oct 2 2012 12:29 AM
Brann - THE BUCK NEGRO.htm HTML File 13.3 KB Oct 2 2012 12:27 AM
brann.pdf PDF Document 67.4 KB Oct 2 2012 12:31 AM
breaking point.pdf PDF Document 97.6 KB Oct 2 2012 12:28 AM
brenner02192003.html HTML File 22.7 KB Oct 2 2012 12:32 AM
Brigham Young's Speech on Slavery, blacks and the Priesthood.htm HTML File 17.2 KB Oct 2 2012 12:33 AM
bringingdemocracytohaiti.html HTML File 27.3 KB Oct 2 2012 12:32 AM
Britain Recruited Muslim Terrorists.htm HTML File 3 KB Oct 2 2012 12:27 AM
Britain’s Racial Diversity Brings Murder; No Justice.htm HTML File 3 KB Oct 2 2012 12:28 AM
Britons Pay Price for Neo-Con Madness.htm HTML File 3.4 KB Oct 2 2012 12:27 AM
Briton tells of Katrina nightmare.htm HTML File 6.4 KB Oct 2 2012 12:29 AM
brochure.pdf PDF Document 1.9 MB Oct 2 2012 12:31 AM
Brooklyn-Based Jew Admits to Trafficking in Women.htm HTML File 4 KB Oct 2 2012 12:32 AM
Brooklyn - Black 'Students' Charged With Anti-White Race Attack.htm HTML File 2.5 KB Oct 2 2012 12:28 AM
Brooklyn Jew Ritually Murders Chickens.htm HTML File 2.1 KB Oct 2 2012 12:33 AM
BruderFlyer.pdf PDF Document 91.3 KB Oct 2 2012 12:30 AM
BugChasers.pdf PDF Document 58.4 KB Oct 2 2012 12:32 AM
Bush - It's All About the Spin.htm HTML File 2.8 KB Oct 2 2012 12:31 AM
Bush Buddy in Flap over Jewish 'Holy Water'.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
bushpoint2.jpg JPEG Image 7.3 KB Oct 2 2012 12:31 AM
Bush Speech Gave Race Hustlers Fresh Ammo.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
bush_911_2005.pdf PDF Document 218.7 KB Oct 2 2012 12:30 AM
bwbw.pdf PDF Document 990.5 KB Oct 2 2012 12:33 AM
By Way Of Deception.htm HTML File 29.2 KB Oct 2 2012 12:29 AM
By way of deception thou shalt do war.htm HTML File 39.1 KB Oct 2 2012 12:30 AM
California - April Gaede Awarded Queen Isabella Prize.htm HTML File 2.9 KB Oct 2 2012 12:34 AM
California - Minuteman Won Election Day Vote.htm HTML File 7 KB Oct 2 2012 12:31 AM
California - Pro-White Music At Folk The System.htm HTML File 10.4 KB Oct 2 2012 12:29 AM
California - Tookie's Son on the Run.htm HTML File 3.4 KB Oct 2 2012 12:33 AM
California - Tookie Executed.htm HTML File 2.6 KB Oct 2 2012 12:32 AM
California Initiative for State Border Police Gaining Ground.htm HTML File 4.7 KB Oct 2 2012 12:32 AM
Camp of the Saints.pdf PDF Document 18.1 KB Oct 2 2012 12:28 AM
Can 'Liberals' Be Educated.htm HTML File 45.2 KB Oct 2 2012 12:33 AM
Canadian Heritage Alliance Articles Letters to Newspapers .doc Microsoft Word Document 22.5 KB Oct 2 2012 12:30 AM
Cannibalism in the African Congo.htm HTML File 12.9 KB Oct 2 2012 12:33 AM
Cans of Paint, Two White Halves, and Chromosomes.htm HTML File 9.4 KB Oct 2 2012 12:31 AM
carplans.zip ZIP Archive 217.7 KB Oct 2 2012 12:32 AM
CarrsTestimony.pdf PDF Document 121.1 KB Oct 2 2012 12:34 AM
CarrsTestimony.rtf RTF File 238.1 KB Oct 2 2012 12:29 AM
catalog.pdf PDF Document 511.1 KB Oct 2 2012 12:29 AM
catalog_pdf0607.htm HTML File 7.4 KB Oct 2 2012 12:31 AM
Catastrophe In Kansas City.htm HTML File 34.6 KB Oct 2 2012 12:34 AM
Catholic Leaders Condemn Anti-Zionism.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
CattleRaidOfCooley.pdf PDF Document 1.2 MB Oct 2 2012 12:33 AM
ccm.pdf PDF Document 9.1 MB Oct 2 2012 12:31 AM
ccm.zip ZIP Archive 3 MB Oct 2 2012 12:33 AM
ccs.pdf PDF Document 8.3 MB Oct 2 2012 12:31 AM
cgc 1.pdf PDF Document 2.4 MB Oct 2 2012 12:33 AM
cgc2.pdf PDF Document 2.9 MB Oct 2 2012 12:30 AM
cgc3.pdf PDF Document 1.3 MB Oct 2 2012 12:29 AM
Challenging the Power of the Jewish Lobby - What Should Be Done.htm HTML File 22.2 KB Oct 2 2012 12:33 AM
Challenging the Power of the Jewish Lobby.htm HTML File 6.6 KB Oct 2 2012 12:30 AM
chapter01.html HTML File 4 KB Oct 2 2012 12:32 AM
chapter02.html HTML File 8 KB Oct 2 2012 12:32 AM
chapter03.html HTML File 10.6 KB Oct 2 2012 12:32 AM
chapter04.html HTML File 5.4 KB Oct 2 2012 12:30 AM
chapter05.html HTML File 5.3 KB Oct 2 2012 12:31 AM
chapter06.html HTML File 12.4 KB Oct 2 2012 12:31 AM
chapter07.html HTML File 15.1 KB Oct 2 2012 12:28 AM
chapter08.html HTML File 20.1 KB Oct 2 2012 12:32 AM
chapter09.html HTML File 4.4 KB Oct 2 2012 12:30 AM
chapter10.html HTML File 34.2 KB Oct 2 2012 12:33 AM
chapter11.html HTML File 13.6 KB Oct 2 2012 12:32 AM
chapter12.html HTML File 16.8 KB Oct 2 2012 12:28 AM
chapter13.html HTML File 12.6 KB Oct 2 2012 12:33 AM
chapter14.html HTML File 8.5 KB Oct 2 2012 12:33 AM
chapter15.html HTML File 20.8 KB Oct 2 2012 12:31 AM
chapter16.html HTML File 7.3 KB Oct 2 2012 12:30 AM
chapter17.html HTML File 8.2 KB Oct 2 2012 12:32 AM
chapter18.html HTML File 6.1 KB Oct 2 2012 12:29 AM
chapter19.html HTML File 10 KB Oct 2 2012 12:33 AM
chapter20.html HTML File 6.5 KB Oct 2 2012 12:29 AM
Chapt_01.htm HTML File 14.4 KB Oct 2 2012 12:31 AM
Chapt_02.htm HTML File 31.7 KB Oct 2 2012 12:33 AM
Chapt_03.htm HTML File 28.1 KB Oct 2 2012 12:31 AM
Chapt_04.htm HTML File 30.8 KB Oct 2 2012 12:31 AM
Chapt_05.htm HTML File 18.2 KB Oct 2 2012 12:33 AM
Chapt_06.htm HTML File 62.9 KB Oct 2 2012 12:33 AM
Chapt_07.htm HTML File 43.2 KB Oct 2 2012 12:33 AM
Chapt_08.htm HTML File 19.3 KB Oct 2 2012 12:31 AM
Chapt_09.htm HTML File 45.7 KB Oct 2 2012 12:30 AM
Chapt_10.htm HTML File 40.8 KB Oct 2 2012 12:27 AM
Chapt_11.htm HTML File 22.5 KB Oct 2 2012 12:28 AM
Chapt_12.htm HTML File 27.5 KB Oct 2 2012 12:31 AM
Chapt_13.htm HTML File 31.5 KB Oct 2 2012 12:27 AM
Chapt_14.htm HTML File 36.1 KB Oct 2 2012 12:31 AM
Chapt_15.htm HTML File 18.8 KB Oct 2 2012 12:33 AM
Chapt_16.htm HTML File 7.8 KB Oct 2 2012 12:28 AM
Chavez Condemned for 'Anti-Semitism'.htm HTML File 2.8 KB Oct 2 2012 12:32 AM
Cherishing an Older Catholicism.htm HTML File 2.5 KB Oct 2 2012 12:32 AM
Chertoff Aide Guilty in Child Porn Case.htm HTML File 5.2 KB Oct 2 2012 12:31 AM
Chertoff Claims He Didn't Have A Clue.htm HTML File 5.8 KB Oct 2 2012 12:30 AM
Chertoff Proposes Non-Profit Spying Group.htm HTML File 2.4 KB Oct 2 2012 12:33 AM
Chertoff Timeline.htm HTML File 10.1 KB Oct 2 2012 12:30 AM
chickenhawks.pdf PDF Document 1.2 MB Oct 2 2012 12:34 AM
Children - National Treasure or Personal Luxury Item.htm HTML File 3.9 KB Oct 2 2012 12:29 AM
China, Deflation And The Dollar.htm HTML File 32.6 KB Oct 2 2012 12:27 AM
chinacautionsisraelagainstsellingawacstoindia.html HTML File 3.5 KB Oct 2 2012 12:31 AM
chinadeploysdronesfromisrael.html HTML File 6.9 KB Oct 2 2012 12:34 AM
chinapreparesforwaragainsttheunitedstates.html HTML File 4.5 KB Oct 2 2012 12:30 AM
China Replaces U.S. As World's Largest Exporter.htm HTML File 6.4 KB Oct 2 2012 12:31 AM
chinasarsenalborninamerica.html HTML File 9 KB Oct 2 2012 12:28 AM
ChinaStealsUSMilitarySecrets.pdf PDF Document 639.7 KB Oct 2 2012 12:28 AM
chinesespyingandthewhitehouse.html HTML File 12.1 KB Oct 2 2012 12:32 AM
Chosen for Pornography.htm HTML File 2.6 KB Oct 2 2012 12:27 AM
Christian Colleges Offer Free Tuition to Katrina Refugees.htm HTML File 3.8 KB Oct 2 2012 12:28 AM
Christian Leaders Urge Third World Flood.htm HTML File 2.6 KB Oct 2 2012 12:30 AM
Christians in Jerusalem Want Jews to Stop Spitting on Them.htm HTML File 3.9 KB Oct 2 2012 12:30 AM
Church asks evacuee to leave.htm HTML File 9.3 KB Oct 2 2012 12:30 AM
Church fighting IRS over anti-war sermon won't give up documents.htm HTML File 8.6 KB Oct 2 2012 12:28 AM
churchillswar1.pdf PDF Document 5.8 MB Oct 2 2012 12:32 AM
churchillswar2.pdf PDF Document 5.1 MB Oct 2 2012 12:31 AM
Chutzpah - Zionists Running Anti-Slavery Organization.htm HTML File 13.2 KB Oct 2 2012 12:28 AM
ci.zip ZIP Archive 908.9 KB Oct 2 2012 12:31 AM
CISReport.pdf PDF Document 220.7 KB Oct 2 2012 12:30 AM
CitizensInformerWinter2005 - Small.pdf PDF Document 2.6 MB Oct 2 2012 12:31 AM
CivilDisobedience.pdf PDF Document 87.8 KB Oct 2 2012 12:31 AM
Civil War in Europe.htm HTML File 5.4 KB Oct 2 2012 12:31 AM
CLARITY.pdf PDF Document 87.6 KB Oct 2 2012 12:31 AM
classical_iq_r2.cgi.htm HTML File 23.6 KB Oct 2 2012 12:33 AM
clinton.pdf PDF Document 72 KB Oct 2 2012 12:31 AM
cofc.pdf PDF Document 1.9 MB Oct 2 2012 12:29 AM
CofCCguide.pdf PDF Document 49.2 KB Oct 2 2012 12:30 AM
collective_punishment.pdf PDF Document 218 KB Oct 2 2012 12:33 AM
color-brochure.pdf PDF Document 571.5 KB Oct 2 2012 12:33 AM
color2.html HTML File 8.7 KB Oct 2 2012 12:29 AM
Colorado - 57 Refugees Have Felony Records.htm HTML File 2.8 KB Oct 2 2012 12:33 AM
COLOR COMMUNISM AND COMMON SENSE.txt Text File 74.7 KB Oct 2 2012 12:34 AM
colorcrime99.pdf PDF Document 399.6 KB Oct 2 2012 12:29 AM
ColorOfCrime.pdf PDF Document 408.4 KB Oct 2 2012 12:31 AM
come-and-hear-complete.zip ZIP Archive 58.3 MB Oct 2 2012 12:28 AM
coming_soon.pdf PDF Document 479.4 KB Oct 2 2012 12:33 AM
communist.html HTML File 44.3 KB Oct 2 2012 12:32 AM
comm_1.html HTML File 48.2 KB Oct 2 2012 12:33 AM
CompilationPresentation.pdf PDF Document 6.3 MB Oct 2 2012 12:27 AM
complaintform_advertising.htm HTML File 2.9 KB Oct 2 2012 12:30 AM
complaintform_bank.htm HTML File 2.5 KB Oct 2 2012 12:33 AM
complaintform_banquet_service.htm HTML File 2.7 KB Oct 2 2012 12:33 AM
complaintform_barber_shop.htm HTML File 2.5 KB Oct 2 2012 12:28 AM
complaintform_beauty_parlor.htm HTML File 2.6 KB Oct 2 2012 12:28 AM
complaintform_church.htm HTML File 3.3 KB Oct 2 2012 12:33 AM
complaintform_department_store.htm HTML File 2.6 KB Oct 2 2012 12:30 AM
complaintform_ethnic_answering_service.htm HTML File 2.6 KB Oct 2 2012 12:28 AM
complaintform_hair_salon.htm HTML File 2.5 KB Oct 2 2012 12:31 AM
complaintform_hospital.htm HTML File 2.5 KB Oct 2 2012 12:32 AM
complaintform_hotel.htm HTML File 2.5 KB Oct 2 2012 12:31 AM
complaintform_motel.htm HTML File 2.5 KB Oct 2 2012 12:32 AM
complaintform_movie_race_mixing.htm HTML File 2.9 KB Oct 2 2012 12:33 AM
complaintform_news_show.htm HTML File 2.9 KB Oct 2 2012 12:34 AM
complaintform_physician_office.htm HTML File 2.5 KB Oct 2 2012 12:33 AM
complaintform_restaurant.htm HTML File 2.8 KB Oct 2 2012 12:33 AM
complaintform_school.htm HTML File 2.7 KB Oct 2 2012 12:32 AM
complaintform_service_station.htm HTML File 2.6 KB Oct 2 2012 12:33 AM
complaintform_store.htm HTML File 2.5 KB Oct 2 2012 12:30 AM
complaintform_theatre.htm HTML File 2.5 KB Oct 2 2012 12:27 AM
CompleteGuide.html HTML File 94.4 KB Oct 2 2012 12:33 AM
Confirmed - Snipers Black.htm HTML File 2.4 KB Oct 2 2012 12:32 AM
Congressional Black Caucus Holds Press Conference.htm HTML File 5.3 KB Oct 2 2012 12:33 AM
Congressman Apologizes, Denies Assaulting Mistress.htm HTML File 2.9 KB Oct 2 2012 12:31 AM
Conservatives; They Refuse to Call It What It Really Is - Genocide.htm HTML File 19.4 KB Oct 2 2012 12:30 AM
Contemporary Trotskyism.htm HTML File 14.4 KB Oct 2 2012 12:31 AM
Controlled Media - Forget the Facts About Katrina.htm HTML File 8.6 KB Oct 2 2012 12:28 AM
ControversyOfZion.pdf PDF Document 1.6 MB Oct 2 2012 12:31 AM
convoypq17.pdf PDF Document 2.5 MB Oct 2 2012 12:30 AM
Corrupting Our Police.htm HTML File 19.9 KB Oct 2 2012 12:28 AM
cosmoe.pdf PDF Document 171.7 KB Oct 2 2012 12:31 AM
cosmosymbol.pdf PDF Document 59.7 KB Oct 2 2012 12:28 AM
Cosmotheism.pdf PDF Document 194.5 KB Oct 2 2012 12:30 AM
Cosmotheism.rtf RTF File 63.8 KB Oct 2 2012 12:31 AM
CostOfIsraelToUS.pdf PDF Document 25.6 KB Oct 2 2012 12:33 AM
CostOfUSMideastPolicy.pdf PDF Document 96.4 KB Oct 2 2012 12:34 AM
Court Temporarily OKs Domestic Spying.htm HTML File 2.6 KB Oct 2 2012 12:28 AM
Court to Tookie - No Thanks, Snitch.htm HTML File 4.4 KB Oct 2 2012 12:33 AM
Covering the 'Kwa - The Inflexible, Utterly Predictable and Parody-Worthy Coverage of Race by the PressWrightCovertheKwa - 11-2005.htm HTML File 12.1 KB Oct 2 2012 12:29 AM
coxreportisarealwhodunit.html HTML File 5.9 KB Oct 2 2012 12:31 AM
Cre88or.ttf TTF File 228 KB Oct 2 2012 12:31 AM
Creamatorium4.pdf PDF Document 70.7 KB Oct 2 2012 12:33 AM
Creaoor - index.html HTML File 2 KB Oct 2 2012 12:29 AM
Creationism and Truth.htm HTML File 4.8 KB Oct 2 2012 12:31 AM
creativity.html HTML File 20.9 KB Oct 2 2012 12:32 AM
Crime Cover-Up in DC.htm HTML File 3.2 KB Oct 2 2012 12:34 AM
CrimeOfOurAge.pdf PDF Document 206.8 KB Oct 2 2012 12:30 AM
Criticism is Not Hate.htm HTML File 9.4 KB Oct 2 2012 12:27 AM
CultureOfCritique.pdf PDF Document 1.9 MB Oct 2 2012 12:28 AM
Curt Maynard - 2006-07-02 - A Frank Discussion of Jewish Group Dynamics.htm HTML File 48.4 KB Oct 2 2012 12:31 AM
Czech Gets Expensive Lesson.htm HTML File 8.6 KB Oct 2 2012 12:28 AM
d2presid.html HTML File 5.2 KB Oct 2 2012 12:30 AM
Daddy_English.pdf PDF Document 413.6 KB Oct 2 2012 12:31 AM
Dallas Cops Nix Katrina Officers.htm HTML File 3.6 KB Oct 2 2012 12:27 AM
Dan Osterton - 2006-07-20 - The Necessity of Invasion.htm HTML File 10.3 KB Oct 2 2012 12:31 AM
dare.pdf PDF Document 348.5 KB Oct 2 2012 12:31 AM
Daryl Bradford Smith - Prepare for the upcoming battle.htm HTML File 20.9 KB Oct 2 2012 12:29 AM
David C Tate - The Cause.pdf PDF Document 166 KB Oct 2 2012 12:32 AM
David Daogherty - 2004-11-12 - The Little-Known World of Pro-White Music.txt Text File 17.1 KB Oct 2 2012 12:30 AM
David Daugherty - 2006-02-09 - Thanks, We Have Our Own Media Now.htm HTML File 16.7 KB Oct 2 2012 12:30 AM
David Duke Discusses Jewish Conspiracy On MSNBC.txt Text File 17.3 KB Oct 2 2012 12:33 AM
David Irving - 1967.pdf PDF Document 937.3 KB Oct 2 2012 12:27 AM
David Irving - Apocalypse.zip ZIP Archive 1.4 MB Oct 2 2012 12:28 AM
David Irving - Generals.zip ZIP Archive 3.5 MB Oct 2 2012 12:30 AM
David Irving - Goebbels.pdf PDF Document 2.9 MB Oct 2 2012 12:33 AM
David Irving - Goering.sit SIT Archive 3.5 MB Oct 2 2012 12:27 AM
David Irving - Hess.zip ZIP Archive 1.8 MB Oct 2 2012 12:31 AM
David Irving - HW1.pdf PDF Document 3.6 MB Oct 2 2012 12:29 AM
David Irving - Keitel.zip ZIP Archive 1 MB Oct 2 2012 12:31 AM
David Irving - MaresNest.zip ZIP Archive 1 MB Oct 2 2012 12:34 AM
David Irving - Milch.zip ZIP Archive 2.1 MB Oct 2 2012 12:32 AM
David Irving - Morell.zip ZIP Archive 880.6 KB Oct 2 2012 12:33 AM
David Irving - Morgenthau_Plan.zip ZIP Archive 215.2 KB Oct 2 2012 12:32 AM
David Irving - NUREMBERG.pdf PDF Document 1.5 MB Oct 2 2012 12:33 AM
David Irving - Pt1.zip ZIP Archive 1.6 MB Oct 2 2012 12:30 AM
David Irving - Pt2.zip ZIP Archive 1.7 MB Oct 2 2012 12:31 AM
David Irving - Pt3.zip ZIP Archive 2.1 MB Oct 2 2012 12:31 AM
David Irving - Pt4.zip ZIP Archive 454.3 KB Oct 2 2012 12:28 AM
David Irving - ReichHoertMit.zip ZIP Archive 1012.9 KB Oct 2 2012 12:31 AM
David Irving - Rommel_illustr.zip ZIP Archive 4.5 MB Oct 2 2012 12:33 AM
David Irving - The Destruction of Convoy PQ. 17 - 1968edition 17 - 1968EDITION File 2.2 MB Oct 2 2012 12:30 AM
David Irving - Uprising.zip ZIP Archive 2 MB Oct 2 2012 12:31 AM
David Irving the 'Anti-Semite'.htm HTML File 5.2 KB Oct 2 2012 12:29 AM
David Lane - 88 Precepts.pdf PDF Document 20.5 KB Oct 2 2012 12:31 AM
David Lane - Dissension in the Ranks.htm HTML File 10.9 KB Oct 2 2012 12:27 AM
David Lane - KD Rebel - 2004.pdf PDF Document 424.8 KB Oct 2 2012 12:30 AM
David Lane - Letter to the Reality Deniers - by David Lane of The Order - P.O.W.txt Text File 14.2 KB Oct 2 2012 12:28 AM
David_Lane - The Final Address of David Lane to the Jury.htm HTML File 5.3 KB Oct 2 2012 12:28 AM
DealingInHate.pdf PDF Document 191.8 KB Oct 2 2012 12:30 AM
Dealing With the Peak Oil Critics.htm HTML File 25.8 KB Oct 2 2012 12:32 AM
Debating the Lobby.htm HTML File 3.1 KB Oct 2 2012 12:33 AM
DebunkingGenocideMyth.pdf PDF Document 771.8 KB Oct 2 2012 12:30 AM
Dec01.pdf PDF Document 1011.5 KB Oct 2 2012 12:27 AM
Dec02.pdf PDF Document 1.3 MB Oct 2 2012 12:28 AM
Dec03.pdf PDF Document 869.2 KB Oct 2 2012 12:31 AM
Dec04.pdf PDF Document 905.8 KB Oct 2 2012 12:28 AM
DeclineOfWest.pdf PDF Document 421.9 KB Oct 2 2012 12:33 AM
Deejay - 'I'm Coming for Your Seed'.htm HTML File 27.8 KB Oct 2 2012 12:31 AM
Deejay’s Appeal - ‘Kill the Whiteness Inside’.htm HTML File 2.1 KB Oct 2 2012 12:31 AM
Defense Firms Making a Killing on Iraq War.htm HTML File 3 KB Oct 2 2012 12:30 AM
Defensible Racism.htm HTML File 11.7 KB Oct 2 2012 12:33 AM
Deir Yassin 1947,.html HTML File 1.3 KB Oct 2 2012 12:29 AM
DemocracyInAmerica.pdf PDF Document 6.7 MB Oct 2 2012 12:28 AM
Democrats Condemn Chertoff's Incompetence.htm HTML File 4 KB Oct 2 2012 12:31 AM
Denver National Vanguard - Supporting the Columbus Day Parade.htm HTML File 4.7 KB Oct 2 2012 12:28 AM
design.pdf PDF Document 173.3 KB Oct 2 2012 12:31 AM
Desperate Jewish News Outlets Abandoning Last Pretenses of Honesty.htm HTML File 2.8 KB Oct 2 2012 12:31 AM
Detainee Paralyzed During Torture in Israeli Prison.htm HTML File 5.1 KB Oct 2 2012 12:31 AM
DetNewsReprint.pdf PDF Document 1.1 MB Oct 2 2012 12:32 AM
Devil's Advocate - The Chinese Have Guts.htm HTML File 7.4 KB Oct 2 2012 12:33 AM
Did Arabs Accidentally Get Canned Pork By Mistake.htm HTML File 3.3 KB Oct 2 2012 12:28 AM
Did Time Magazine Lie to Pad Circulation.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
Disaster Buck Stopped at Chertoff, Not Brown.htm HTML File 3.5 KB Oct 2 2012 12:31 AM
Discussing Race in a Globalized World.htm HTML File 11.5 KB Oct 2 2012 12:33 AM
diversity.pdf PDF Document 503.4 KB Oct 2 2012 12:31 AM
DiversityAtWork.pdf PDF Document 76.3 KB Oct 2 2012 12:28 AM
Diversity Can Only Be Countered With Brutality And War.htm HTML File 46.5 KB Oct 2 2012 12:29 AM
Dividing the World.htm HTML File 22.4 KB Oct 2 2012 12:31 AM
Do Blacks Deserve Billions for Slavery.htm HTML File 11.9 KB Oct 2 2012 12:33 AM
doles.pdf PDF Document 61.2 KB Oct 2 2012 12:33 AM
Do They Think It’s Worth It.htm HTML File 12.6 KB Oct 2 2012 12:33 AM
Doty_H2Price.pdf PDF Document 330.3 KB Oct 2 2012 12:27 AM
Do Whites Really Deserve to Exist.htm HTML File 9.7 KB Oct 2 2012 12:32 AM
downedchinesef8carriedisraelimissile.html HTML File 2 KB Oct 2 2012 12:30 AM
Dr. David Duke - My Awakening - Complete Book from SolarGeneral_com.pdf PDF Document 24.9 MB Oct 2 2012 12:29 AM
Dr. Lorraine Day’s Response to Judy Andreas - zionism.htm HTML File 59.8 KB Oct 2 2012 12:33 AM
Dr. William Pierce - The Turner Diaries.pdf PDF Document 809.7 KB Oct 2 2012 12:29 AM
DR Congo's atrocious secret.htm HTML File 18.8 KB Oct 2 2012 12:27 AM
Dreaming of a Black Christmas.htm HTML File 5.1 KB Oct 2 2012 12:33 AM
Dream of inter-racial cooperation finally a UK reality.htm HTML File 2.6 KB Oct 2 2012 12:31 AM
dresden.pdf PDF Document 974.8 KB Oct 2 2012 12:28 AM
dresden1995.pdf PDF Document 763.7 KB Oct 2 2012 12:31 AM
dropthelist.htm HTML File 21.9 KB Oct 2 2012 12:32 AM
Drug Feud Claims Life of Anti-White Activist.htm HTML File 5.2 KB Oct 2 2012 12:33 AM
dth.pdf PDF Document 16 MB Oct 2 2012 12:28 AM
dth.zip ZIP Archive 6 MB Oct 2 2012 12:30 AM
Dumbing Down America.htm HTML File 4.1 KB Oct 2 2012 12:30 AM
DuneSeries.zip ZIP Archive 7.1 MB Oct 2 2012 12:31 AM
Dutch Inquisition Reborn.htm HTML File 6.7 KB Oct 2 2012 12:34 AM
Dutch to Become First European Nation to Ban Burka.htm HTML File 2.2 KB Oct 2 2012 12:33 AM
Dynohub_assembly.pdf PDF Document 263.7 KB Oct 2 2012 12:28 AM
EBlowback_911.pdf PDF Document 7.7 MB Oct 2 2012 12:31 AM
Ebonics Suggested for District.htm HTML File 2.4 KB Oct 2 2012 12:30 AM
ec.pdf PDF Document 906.4 KB Oct 2 2012 12:32 AM
EcritsRevisionnistes.pdf PDF Document 270.9 KB Oct 2 2012 12:33 AM
EdictOfExpulsion.pdf PDF Document 40.8 KB Oct 2 2012 12:31 AM
Editing Martin Luther King, Jr.htm HTML File 37.4 KB Oct 2 2012 12:31 AM
Educational Sabotage.htm HTML File 35 KB Oct 2 2012 12:31 AM
Educators Baffled at Stubborn Achievement Gap.htm HTML File 12.8 KB Oct 2 2012 12:32 AM
Edward Fagan Sues Lloyd's of London, U.S. Government.htm HTML File 3.4 KB Oct 2 2012 12:31 AM
Edwards.pdf PDF Document 64.2 KB Oct 2 2012 12:31 AM
EFBI_CIA_mob_treachery.pdf PDF Document 2.7 MB Oct 2 2012 12:28 AM
einstein-prioritymyth.htm HTML File 21 KB Oct 2 2012 12:30 AM
EinsteinConspiracy.pdf PDF Document 462.9 KB Oct 2 2012 12:31 AM
EinsteinHoax.pdf PDF Document 3.8 MB Oct 2 2012 12:28 AM
EinsteinStoleE=mc2.htm HTML File 10.1 KB Oct 2 2012 12:31 AM
EIraq_lies.pdf PDF Document 4.1 MB Oct 2 2012 12:32 AM
Eire - YOU DID IT! Now Let's Build On the Success.htm HTML File 4.3 KB Oct 2 2012 12:31 AM
EisenhowersHolocaust.pdf PDF Document 19.8 KB Oct 2 2012 12:27 AM
Elias Lönnrot - The Kalevala - 1888.pdf PDF Document 1 MB Oct 2 2012 12:28 AM
Elizabeth Smith - A Woman Looks at the Lifetime Channel.htm HTML File 10.2 KB Oct 2 2012 12:32 AM
Ellin Anderson - 2005-12-22 - In This Sign.txt Text File 13.8 KB Oct 2 2012 12:31 AM
Empowerment by Rape - the Sexual Holocaust.htm HTML File 13.4 KB Oct 2 2012 12:31 AM
endimmigration.pdf PDF Document 91.3 KB Oct 2 2012 12:33 AM
Ending the Dollar's Tyranny.htm HTML File 19.4 KB Oct 2 2012 12:30 AM
EndKingHolodayNew.pdf PDF Document 109.4 KB Oct 2 2012 12:31 AM
End of an Era - Spearhead to Close.htm HTML File 2.6 KB Oct 2 2012 12:31 AM
End of the Rainbow.htm HTML File 4.9 KB Oct 2 2012 12:32 AM
EndTheKingHoloday.pdf PDF Document 222.5 KB Oct 2 2012 12:31 AM
EnemyOfEurope.pdf PDF Document 545.8 KB Oct 2 2012 12:33 AM
England Prepares to Honor Millenium of First Patron Saint.htm HTML File 4.4 KB Oct 2 2012 12:31 AM
English Lad 'Too Pale'.htm HTML File 2.7 KB Oct 2 2012 12:33 AM
Englishman's Zimbabwean Road Trip to Texas.htm HTML File 2.7 KB Oct 2 2012 12:33 AM
Enron - A Microcosm of America.htm HTML File 5.8 KB Oct 2 2012 12:32 AM
en_gentiles - Gentiles in Halacha.zip ZIP Archive 64.8 KB Oct 2 2012 12:28 AM
en_gentiles1 - Gentiles in Halacha.zip ZIP Archive 8.3 KB Oct 2 2012 12:32 AM
Erik the Norseman A Nation Betrayed.doc Microsoft Word Document 33.5 KB Oct 2 2012 12:32 AM
Erik the Norseman An Essay on Comparative Horror.doc Microsoft Word Document 28 KB Oct 2 2012 12:27 AM
Erik the Norseman Boy Meets Boy - Boy Takes Boy to the Prom.doc Microsoft Word Document 25 KB Oct 2 2012 12:33 AM
Erik the Norseman Canada Diagnosis - CRITICAL.doc Microsoft Word Document 25 KB Oct 2 2012 12:28 AM
Erik the Norseman Canadian Homelessness - A White Problem.doc Microsoft Word Document 30 KB Oct 2 2012 12:28 AM
Erik the Norseman Canadians Can Say What They Want, Eh!.doc Microsoft Word Document 24 KB Oct 2 2012 12:33 AM
Erik the Norseman GOOD MORNING CANADA! Wake Up and Smell the.doc Microsoft Word Document 26.5 KB Oct 2 2012 12:34 AM
Erik the Norseman Iraq Proof Islam is a Nest of Vipers.doc Microsoft Word Document 29.5 KB Oct 2 2012 12:31 AM
Erik the Norseman Just Who Is an Aboriginal.doc Microsoft Word Document 30 KB Oct 2 2012 12:31 AM
Erik the Norseman Loss of Sovereignty to Globalism.doc Microsoft Word Document 28.5 KB Oct 2 2012 12:27 AM
Erik the Norseman Misplaced Hate.doc Microsoft Word Document 26 KB Oct 2 2012 12:31 AM
Erik the Norseman Paul Fromm Speaks in Vancouver Another suc.doc Microsoft Word Document 28 KB Oct 2 2012 12:30 AM
Erik the Norseman Promotion Anyone.doc Microsoft Word Document 26.5 KB Oct 2 2012 12:31 AM
Erik the Norseman Same Rights = Special Rights.doc Microsoft Word Document 28 KB Oct 2 2012 12:28 AM
Erik the Norseman SARS Politically Correct Disease.doc Microsoft Word Document 40 KB Oct 2 2012 12:32 AM
Erik the Norseman Some Dominion Day Reflections on the Benef.doc Microsoft Word Document 29 KB Oct 2 2012 12:31 AM
Erik the Norseman Some Thoughts of a Proud Racialist.doc Microsoft Word Document 33 KB Oct 2 2012 12:30 AM
Erik the Norseman Some Thoughts on Abortion.doc Microsoft Word Document 29.5 KB Oct 2 2012 12:28 AM
Erik the Norseman Some Thoughts on Native Land Claims.doc Microsoft Word Document 33 KB Oct 2 2012 12:28 AM
Erik the Norseman Some Thoughts on Privatization.doc Microsoft Word Document 29 KB Oct 2 2012 12:33 AM
Erik the Norseman Some Thoughts on the Future of Transportat.doc Microsoft Word Document 24.5 KB Oct 2 2012 12:30 AM
Erik the Norseman Some Thoughts on the Judiciary.doc Microsoft Word Document 35.5 KB Oct 2 2012 12:31 AM
Erik the Norseman Some Thoughts on the Prison System.doc Microsoft Word Document 28.5 KB Oct 2 2012 12:34 AM
Erik the Norseman The Paradox of Complimentary Medicine.doc Microsoft Word Document 26 KB Oct 2 2012 12:28 AM
Erik the Norseman The People's Lament.doc Microsoft Word Document 58.5 KB Oct 2 2012 12:30 AM
Erik the Norseman The Zahra Kazemi Debaucle Back in the News.doc Microsoft Word Document 29 KB Oct 2 2012 12:31 AM
Erik the Norseman What Is an Aboriginal.doc Microsoft Word Document 28.5 KB Oct 2 2012 12:28 AM
Erik the Norseman When is a Jew a Jew A call to White Evange.doc Microsoft Word Document 25.5 KB Oct 2 2012 12:33 AM
Erik the Norseman White Pride or White Guilt.doc Microsoft Word Document 39.5 KB Oct 2 2012 12:27 AM
Erik the Norseman Who are the Welfare Bums.doc Microsoft Word Document 26.5 KB Oct 2 2012 12:30 AM
Erik the Norseman Who Built Canada.doc Microsoft Word Document 24.5 KB Oct 2 2012 12:30 AM
essentialphysics1.pdf PDF Document 947.7 KB Oct 2 2012 12:30 AM
Ethiopian Government Begs After Bumper Crop.htm HTML File 2.2 KB Oct 2 2012 12:31 AM
eugenics.htm HTML File 32.9 KB Oct 2 2012 12:29 AM
eugenics.html HTML File 32.9 KB Oct 2 2012 12:31 AM
EugenicsManifesto.pdf PDF Document 346.2 KB Oct 2 2012 12:27 AM
EURO-DNA1.0 & ANCESTRYBYDNA2.5 - USER MANUAL.pdf PDF Document 249.1 KB Oct 2 2012 12:30 AM
Euro 2005 DVD.htm HTML File 2.5 KB Oct 2 2012 12:32 AM
European Origins of Halloween.htm HTML File 6.2 KB Oct 2 2012 12:28 AM
Europeans Having Second Thoughts about Turkey.htm HTML File 6 KB Oct 2 2012 12:31 AM
European Union Applies 'Hate Speech' Rules to Internet.htm HTML File 2.1 KB Oct 2 2012 12:30 AM
Europe’s Successful Moon Probe Mission.htm HTML File 5.7 KB Oct 2 2012 12:28 AM
Euro Slurs and Hate Caricatures.htm HTML File 22.3 KB Oct 2 2012 12:33 AM
euvolution.pdf PDF Document 3.7 MB Oct 2 2012 12:28 AM
Evan Thomas 2005-11-04 - UN to Celebrate Jan. 27 as 'Holocaust Day' 27 AS 'HOLOCAUST DAY' File 5.1 KB Oct 2 2012 12:29 AM
Ex-IRA Soldier Condemns Loss of Traditional Ireland.htm HTML File 3 KB Oct 2 2012 12:28 AM
Ex-Security Chief Blows Whistle on UN's Kosovo Mission.htm HTML File 4.6 KB Oct 2 2012 12:30 AM
Exercise, It’s Not What Your Doctor Prescribed.htm HTML File 3.7 KB Oct 2 2012 12:33 AM
exiles.zip ZIP Archive 129.8 KB Oct 2 2012 12:31 AM
Exodus Remembered_ Passover Inspires Parasite Jewish Concern for Immigrants (But None for Well-Being of Host Nation Citizens).html HTML File 40.8 KB Oct 2 2012 12:28 AM
F95-2.htm HTML File 8.4 KB Oct 2 2012 12:33 AM
Facts.pdf PDF Document 2.7 MB Oct 2 2012 12:33 AM
Facts To Consider Concerning The Holocaust.htm HTML File 120.4 KB Oct 2 2012 12:30 AM
Fading Illusions - D-Day and Reagan.htm HTML File 26.4 KB Oct 2 2012 12:27 AM
Fagan Files $1 Billion 'Holocaust Compensation' Lawsuit.htm HTML File 3.1 KB Oct 2 2012 12:28 AM
FagFacts.pdf PDF Document 194.1 KB Oct 2 2012 12:31 AM
FagFlyer.pdf PDF Document 50.3 KB Oct 2 2012 12:31 AM
failurerateonmathtestup50percentincounty.html HTML File 4.9 KB Oct 2 2012 12:28 AM
Failures of Our Age - Capitalism and Communism.htm HTML File 23.9 KB Oct 2 2012 12:33 AM
fame.css Stylesheet 784 Bytes Oct 2 2012 12:31 AM
fame.pdf PDF Document 2.3 MB Oct 2 2012 12:31 AM
fame.zip ZIP Archive 450.4 KB Oct 2 2012 12:28 AM
famedeadmansdeeds.pdf PDF Document 2.3 MB Oct 2 2012 12:34 AM
Famous people with Scotch Irish blood.htm HTML File 105.3 KB Oct 2 2012 12:32 AM
faq.html HTML File 58.4 KB Oct 2 2012 12:27 AM
faq_francaise.html HTML File 58.7 KB Oct 2 2012 12:33 AM
Farewell to a Good European.htm HTML File 6.3 KB Oct 2 2012 12:31 AM
Fast Times at Regnef High - crying-wolf.htm HTML File 37.1 KB Oct 2 2012 12:33 AM
Fear and Illusion.htm HTML File 3.5 KB Oct 2 2012 12:31 AM
FearAndTrembling.pdf PDF Document 324.8 KB Oct 2 2012 12:32 AM
Feb01.pdf PDF Document 392.4 KB Oct 2 2012 12:28 AM
Feb02.pdf PDF Document 1.7 MB Oct 2 2012 12:29 AM
feb03.pdf PDF Document 1.6 MB Oct 2 2012 12:28 AM
Feb04.pdf PDF Document 1.9 MB Oct 2 2012 12:34 AM
Feds Say Katrina Refugee Gangs a Threat.htm HTML File 3.4 KB Oct 2 2012 12:33 AM
FestumAlbum.doc Microsoft Word Document 540 KB Oct 2 2012 12:27 AM
FEST_FLIER.pdf PDF Document 8.5 KB Oct 2 2012 12:27 AM
Fewer Than 50,000 Whites in Zimbabwe.htm HTML File 3.4 KB Oct 2 2012 12:33 AM
FFNewsF05.pdf PDF Document 668 KB Oct 2 2012 12:30 AM
fhe part1.pdf PDF Document 13.6 MB Oct 2 2012 12:27 AM
fhe part2.pdf PDF Document 9.9 MB Oct 2 2012 12:33 AM
fhe part3.pdf PDF Document 15.4 MB Oct 2 2012 12:31 AM
fhe part4.pdf PDF Document 7.3 MB Oct 2 2012 12:30 AM
fhe part5.pdf PDF Document 5.4 MB Oct 2 2012 12:32 AM
fhe part6.pdf PDF Document 4.7 MB Oct 2 2012 12:29 AM
fhe part7.pdf PDF Document 3.6 MB Oct 2 2012 12:27 AM
fhe part8.pdf PDF Document 4.2 MB Oct 2 2012 12:31 AM
fhe part9.pdf PDF Document 14 MB Oct 2 2012 12:32 AM
fhe part10.pdf PDF Document 9.6 MB Oct 2 2012 12:34 AM
fhe part11.pdf PDF Document 6.9 MB Oct 2 2012 12:33 AM
fhe part12.pdf PDF Document 857.3 KB Oct 2 2012 12:28 AM
Fighting Organized Crime.htm HTML File 26.4 KB Oct 2 2012 12:28 AM
Final Verdict - The false connection between Tim McVeigh and The Turner Diaries.htm HTML File 27.8 KB Oct 2 2012 12:31 AM
Finkelstein Debates Israeli Pol.htm HTML File 15.1 KB Oct 2 2012 12:31 AM
first10years.doc Microsoft Word Document 110 KB Oct 2 2012 12:33 AM
FirstTheyCameForTheArabs.pdf PDF Document 18.7 KB Oct 2 2012 12:30 AM
Five Myths That Sanction Israel's War Crimes.htm HTML File 50.3 KB Oct 2 2012 12:33 AM
FLIER-1.pdf PDF Document 110.9 KB Oct 2 2012 12:27 AM
FLIER-2.pdf PDF Document 46 KB Oct 2 2012 12:32 AM
FLIER-3.pdf PDF Document 51.1 KB Oct 2 2012 12:31 AM
FLIER-4.pdf PDF Document 80.4 KB Oct 2 2012 12:27 AM
FLIER-5.pdf PDF Document 84.7 KB Oct 2 2012 12:30 AM
fliers.html HTML File 43.7 KB Oct 2 2012 12:34 AM
FlorentineChronicle.pdf PDF Document 40.9 KB Oct 2 2012 12:32 AM
Florida - 'King Tut' Prompts Black Protests.htm HTML File 3.9 KB Oct 2 2012 12:34 AM
Florida - Homeowners Association Says 'No' to Evacuees.htm HTML File 3.7 KB Oct 2 2012 12:31 AM
Florida - Vote Ubele.htm HTML File 2.9 KB Oct 2 2012 12:31 AM
Florida School Board Rejects Hall's Resignation.htm HTML File 3.5 KB Oct 2 2012 12:33 AM
FLYER-6.pdf PDF Document 88.1 KB Oct 2 2012 12:27 AM
Flyer.pdf PDF Document 486.8 KB Oct 2 2012 12:33 AM
FOMCalendar.pdf PDF Document 91.7 KB Oct 2 2012 12:31 AM
ForeignersAroundTheWorld.pdf PDF Document 740.5 KB Oct 2 2012 12:34 AM
Foreword to the new edition - Zundel's Story.htm HTML File 31.2 KB Oct 2 2012 12:32 AM
Former Reps. Earl Hilliard (D-Ala.) and Cynthia McKinney (D-Ga.) - Bad for Israel.htm HTML File 4 KB Oct 2 2012 12:29 AM
foundingizzymyths.pdf PDF Document 916.3 KB Oct 2 2012 12:30 AM
foundingizzymyths.rtf RTF File 525.9 KB Oct 2 2012 12:29 AM
France - Another 'Hate Crime' Hoax.htm HTML File 2.7 KB Oct 2 2012 12:30 AM
France - Chirac Calls for Police State to Enforce Multiracialism.htm HTML File 5.4 KB Oct 2 2012 12:28 AM
France - Teacher in Hiding.htm HTML File 3.4 KB Oct 2 2012 12:33 AM
France - Turks Must Admit Genocide.htm HTML File 3 KB Oct 2 2012 12:27 AM
France Lays Dauphin to Rest.htm HTML File 5.2 KB Oct 2 2012 12:30 AM
frankdiaryfraud.pdf PDF Document 111.4 KB Oct 2 2012 12:30 AM
Frank Ellis article (unedited) - 2006-03-27 - Chris Brand comment.txt Text File 24.5 KB Oct 2 2012 12:33 AM
Frankfurt School Aikido.htm HTML File 26.7 KB Oct 2 2012 12:32 AM
FrankLynchedLarge.jpeg JPEG Image 77.5 KB Oct 2 2012 12:33 AM
Frank Roman - 2006-10-07 - Impeach The System.htm HTML File 6.4 KB Oct 2 2012 12:30 AM
freeamericaflyer.pdf PDF Document 127.4 KB Oct 2 2012 12:32 AM
Free Pro-European Music.htm HTML File 2.8 KB Oct 2 2012 12:28 AM
Free Speech Can Be Fatal.htm HTML File 4.9 KB Oct 2 2012 12:31 AM
Free Speech Hypocrisy.htm HTML File 1.9 KB Oct 2 2012 12:32 AM
free_irving.pdf PDF Document 471.4 KB Oct 2 2012 12:31 AM
French culture in vice grip of Muslims both internally and externally.htm HTML File 3.9 KB Oct 2 2012 12:30 AM
Friends of Ulster - USA Scotch Irish _ Ulster Scots.htm HTML File 419.1 KB Oct 2 2012 12:31 AM
FRIPamphlets.pdf PDF Document 727.2 KB Oct 2 2012 12:28 AM
Front National MP Suspended from Teaching Position for Calling for Open Debate.htm HTML File 2.8 KB Oct 2 2012 12:34 AM
fs001a.html HTML File 19.1 KB Oct 2 2012 12:32 AM
fs001b.html HTML File 19.5 KB Oct 2 2012 12:34 AM
fs001c.html HTML File 18.8 KB Oct 2 2012 12:32 AM
fs001d.html HTML File 19.2 KB Oct 2 2012 12:33 AM
fs0010a.html HTML File 19.8 KB Oct 2 2012 12:31 AM
fs0010b.html HTML File 19.5 KB Oct 2 2012 12:31 AM
fs0010c.html HTML File 19.4 KB Oct 2 2012 12:31 AM
fs0010d.html HTML File 20 KB Oct 2 2012 12:28 AM
fs0011a.html HTML File 19.9 KB Oct 2 2012 12:33 AM
fs0011b.html HTML File 20.1 KB Oct 2 2012 12:33 AM
fs0011c.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs0011d.html HTML File 19.6 KB Oct 2 2012 12:31 AM
fs0012a.html HTML File 19.2 KB Oct 2 2012 12:29 AM
fs0012b.html HTML File 20 KB Oct 2 2012 12:32 AM
fs0012c.html HTML File 19.8 KB Oct 2 2012 12:31 AM
fs0012d.html HTML File 19.2 KB Oct 2 2012 12:31 AM
fs002a.html HTML File 19.5 KB Oct 2 2012 12:28 AM
fs002b.html HTML File 19.2 KB Oct 2 2012 12:32 AM
fs002c.html HTML File 19 KB Oct 2 2012 12:27 AM
fs002d.html HTML File 20.5 KB Oct 2 2012 12:33 AM
fs003a.html HTML File 20 KB Oct 2 2012 12:33 AM
fs003b.html HTML File 19.8 KB Oct 2 2012 12:29 AM
fs003c.html HTML File 19.2 KB Oct 2 2012 12:29 AM
fs003d.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs004a.html HTML File 19.5 KB Oct 2 2012 12:29 AM
fs004b.html HTML File 19.2 KB Oct 2 2012 12:31 AM
fs004c.html HTML File 19.2 KB Oct 2 2012 12:31 AM
fs004d.html HTML File 19.8 KB Oct 2 2012 12:33 AM
fs005a.html HTML File 20 KB Oct 2 2012 12:28 AM
fs005b.html HTML File 20 KB Oct 2 2012 12:29 AM
fs005c.html HTML File 20.2 KB Oct 2 2012 12:29 AM
fs005d.html HTML File 19.2 KB Oct 2 2012 12:30 AM
fs006a.html HTML File 20.3 KB Oct 2 2012 12:31 AM
fs006b.html HTML File 19.7 KB Oct 2 2012 12:30 AM
fs006c.html HTML File 19.7 KB Oct 2 2012 12:29 AM
fs006d.html HTML File 19.7 KB Oct 2 2012 12:28 AM
fs007a.html HTML File 20 KB Oct 2 2012 12:31 AM
fs007b.html HTML File 19.6 KB Oct 2 2012 12:31 AM
fs007c.html HTML File 20.3 KB Oct 2 2012 12:29 AM
fs007d.html HTML File 20 KB Oct 2 2012 12:33 AM
fs008a.html HTML File 19.4 KB Oct 2 2012 12:31 AM
fs008b.html HTML File 19.8 KB Oct 2 2012 12:28 AM
fs008c.html HTML File 19.9 KB Oct 2 2012 12:31 AM
fs008d.html HTML File 20.4 KB Oct 2 2012 12:33 AM
fs009a.html HTML File 19.9 KB Oct 2 2012 12:33 AM
fs009b.html HTML File 19.1 KB Oct 2 2012 12:32 AM
fs009c.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs009d.html HTML File 19.4 KB Oct 2 2012 12:33 AM
fs0101a.html HTML File 20 KB Oct 2 2012 12:33 AM
fs0101b.html HTML File 20.2 KB Oct 2 2012 12:28 AM
fs0101c.html HTML File 20.4 KB Oct 2 2012 12:31 AM
fs0101d.html HTML File 20.4 KB Oct 2 2012 12:33 AM
fs0102a.html HTML File 19.7 KB Oct 2 2012 12:33 AM
fs0102b.html HTML File 20.3 KB Oct 2 2012 12:30 AM
fs0102c.html HTML File 19.1 KB Oct 2 2012 12:28 AM
fs0102d.html HTML File 19.8 KB Oct 2 2012 12:32 AM
fs0103a.html HTML File 20.3 KB Oct 2 2012 12:31 AM
fs0103b.html HTML File 20 KB Oct 2 2012 12:30 AM
fs0103c.html HTML File 20.1 KB Oct 2 2012 12:33 AM
fs0103d.html HTML File 20.4 KB Oct 2 2012 12:28 AM
fs0104a.html HTML File 20.1 KB Oct 2 2012 12:31 AM
fs0104b.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs0104c.html HTML File 19.8 KB Oct 2 2012 12:27 AM
fs0104d.html HTML File 20.2 KB Oct 2 2012 12:31 AM
fs0105a.html HTML File 19.5 KB Oct 2 2012 12:28 AM
fs0105b.html HTML File 20.1 KB Oct 2 2012 12:28 AM
fs0105c.html HTML File 19.9 KB Oct 2 2012 12:31 AM
fs0105d.html HTML File 19.1 KB Oct 2 2012 12:33 AM
fs0106a.html HTML File 19.1 KB Oct 2 2012 12:31 AM
fs0106b.html HTML File 19.9 KB Oct 2 2012 12:28 AM
fs0106c.html HTML File 18.5 KB Oct 2 2012 12:30 AM
fs0106d.html HTML File 20.2 KB Oct 2 2012 12:34 AM
fs0107a.html HTML File 19.8 KB Oct 2 2012 12:28 AM
fs0107b.html HTML File 19.7 KB Oct 2 2012 12:32 AM
fs0107c.html HTML File 20.1 KB Oct 2 2012 12:27 AM
fs0107d.html HTML File 20.2 KB Oct 2 2012 12:31 AM
fs0108a.html HTML File 19.9 KB Oct 2 2012 12:32 AM
fs0108b.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs0108c.html HTML File 20.1 KB Oct 2 2012 12:30 AM
fs0108d.html HTML File 19.2 KB Oct 2 2012 12:31 AM
fs0109a.html HTML File 20.1 KB Oct 2 2012 12:33 AM
fs0109b.html HTML File 20.4 KB Oct 2 2012 12:31 AM
fs0109c.html HTML File 20.3 KB Oct 2 2012 12:30 AM
fs0109d.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs0110a.html HTML File 20.4 KB Oct 2 2012 12:28 AM
fs0110b.html HTML File 21.9 KB Oct 2 2012 12:34 AM
fs0110c.html HTML File 20.5 KB Oct 2 2012 12:31 AM
fs0110d.html HTML File 20.2 KB Oct 2 2012 12:33 AM
fs0111a.html HTML File 20.7 KB Oct 2 2012 12:28 AM
fs0111b.html HTML File 20.1 KB Oct 2 2012 12:28 AM
fs0111c.html HTML File 20.5 KB Oct 2 2012 12:33 AM
fs0111d.html HTML File 21.2 KB Oct 2 2012 12:31 AM
fs0112a.html HTML File 19.2 KB Oct 2 2012 12:31 AM
fs0112b.html HTML File 20 KB Oct 2 2012 12:28 AM
fs0112c.html HTML File 20.2 KB Oct 2 2012 12:27 AM
fs0112d.html HTML File 20.4 KB Oct 2 2012 12:31 AM
FS02-10.pdf PDF Document 1.1 MB Oct 2 2012 12:30 AM
fs0201a.html HTML File 20.2 KB Oct 2 2012 12:33 AM
fs0201b.html HTML File 19.8 KB Oct 2 2012 12:33 AM
fs0201c.html HTML File 20 KB Oct 2 2012 12:30 AM
fs0201d.html HTML File 19.9 KB Oct 2 2012 12:32 AM
fs0202a.html HTML File 19.7 KB Oct 2 2012 12:29 AM
fs0202b.html HTML File 20.2 KB Oct 2 2012 12:29 AM
fs0202c.html HTML File 20.2 KB Oct 2 2012 12:34 AM
fs0202d.html HTML File 20.6 KB Oct 2 2012 12:32 AM
fs0203a.html HTML File 20.2 KB Oct 2 2012 12:30 AM
fs0203b.html HTML File 20 KB Oct 2 2012 12:32 AM
fs0203c.html HTML File 19.3 KB Oct 2 2012 12:33 AM
fs0203d.html HTML File 20.1 KB Oct 2 2012 12:27 AM
fs0204a.html HTML File 20.3 KB Oct 2 2012 12:34 AM
fs0204b.html HTML File 19.4 KB Oct 2 2012 12:28 AM
fs0204c.html HTML File 20.3 KB Oct 2 2012 12:34 AM
fs0204d.html HTML File 20.2 KB Oct 2 2012 12:28 AM
fs0205a.html HTML File 19.5 KB Oct 2 2012 12:32 AM
fs0205b.html HTML File 19.9 KB Oct 2 2012 12:31 AM
fs0205c.html HTML File 19.3 KB Oct 2 2012 12:29 AM
fs0205d.html HTML File 20.5 KB Oct 2 2012 12:31 AM
fs0206a.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs0206b.html HTML File 19.7 KB Oct 2 2012 12:28 AM
fs0206c.html HTML File 20.1 KB Oct 2 2012 12:33 AM
fs0206d.html HTML File 19.7 KB Oct 2 2012 12:34 AM
fs0207a.html HTML File 20.3 KB Oct 2 2012 12:29 AM
fs0207b.html HTML File 19.4 KB Oct 2 2012 12:31 AM
fs0207c.html HTML File 19.7 KB Oct 2 2012 12:27 AM
fs0207d.html HTML File 20.2 KB Oct 2 2012 12:29 AM
fs0208a.html HTML File 20.2 KB Oct 2 2012 12:33 AM
fs0208b.html HTML File 19.5 KB Oct 2 2012 12:27 AM
fs0208c.html HTML File 39.1 KB Oct 2 2012 12:28 AM
fs0209a.html HTML File 15.8 KB Oct 2 2012 12:32 AM
fs0209b.html HTML File 21.8 KB Oct 2 2012 12:28 AM
fs0209c.html HTML File 19.1 KB Oct 2 2012 12:33 AM
fs0209d.html HTML File 20.4 KB Oct 2 2012 12:27 AM
fs951a.html HTML File 19.7 KB Oct 2 2012 12:30 AM
fs951b.html HTML File 18.5 KB Oct 2 2012 12:31 AM
fs951c.html HTML File 20 KB Oct 2 2012 12:32 AM
fs951d.html HTML File 9 KB Oct 2 2012 12:28 AM
fs952a.html HTML File 18.3 KB Oct 2 2012 12:33 AM
fs952b.html HTML File 8.4 KB Oct 2 2012 12:31 AM
fs952c.html HTML File 10.4 KB Oct 2 2012 12:32 AM
fs952d.html HTML File 6.7 KB Oct 2 2012 12:33 AM
fs952e.html HTML File 17 KB Oct 2 2012 12:31 AM
fs953a.html HTML File 9.5 KB Oct 2 2012 12:33 AM
fs953b.html HTML File 6.8 KB Oct 2 2012 12:31 AM
fs953c.html HTML File 18.6 KB Oct 2 2012 12:33 AM
fs953d.html HTML File 12.9 KB Oct 2 2012 12:34 AM
fs953e.html HTML File 15.6 KB Oct 2 2012 12:34 AM
fs954a.html HTML File 17.9 KB Oct 2 2012 12:34 AM
fs954b.html HTML File 33 KB Oct 2 2012 12:32 AM
fs954c.html HTML File 18.5 KB Oct 2 2012 12:31 AM
fs955a.html HTML File 18 KB Oct 2 2012 12:31 AM
fs955b.html HTML File 20.2 KB Oct 2 2012 12:34 AM
fs955c.html HTML File 18.7 KB Oct 2 2012 12:29 AM
fs955d.html HTML File 20.3 KB Oct 2 2012 12:34 AM
fs956a.html HTML File 37.8 KB Oct 2 2012 12:33 AM
fs956b.html HTML File 31.2 KB Oct 2 2012 12:33 AM
fs957a.html HTML File 16.8 KB Oct 2 2012 12:29 AM
fs957b.html HTML File 16.9 KB Oct 2 2012 12:33 AM
fs957c.html HTML File 9.2 KB Oct 2 2012 12:33 AM
fs957d.html HTML File 5.3 KB Oct 2 2012 12:31 AM
fs957e.html HTML File 8.1 KB Oct 2 2012 12:28 AM
fs958a.html HTML File 22.3 KB Oct 2 2012 12:34 AM
fs958d.html HTML File 18.1 KB Oct 2 2012 12:32 AM
fs958e.html HTML File 18.5 KB Oct 2 2012 12:32 AM
fs958f.html HTML File 7.1 KB Oct 2 2012 12:31 AM
fs959a.html HTML File 19 KB Oct 2 2012 12:32 AM
fs959b.html HTML File 4.7 KB Oct 2 2012 12:28 AM
fs959c.html HTML File 16.1 KB Oct 2 2012 12:30 AM
fs959d.html HTML File 14.9 KB Oct 2 2012 12:29 AM
fs961a.html HTML File 19 KB Oct 2 2012 12:33 AM
fs961b.html HTML File 18.5 KB Oct 2 2012 12:32 AM
fs961c.html HTML File 16.3 KB Oct 2 2012 12:34 AM
fs961d.html HTML File 20.6 KB Oct 2 2012 12:32 AM
fs962a.html HTML File 17.4 KB Oct 2 2012 12:28 AM
fs962b.html HTML File 19 KB Oct 2 2012 12:28 AM
fs962c.html HTML File 3.5 KB Oct 2 2012 12:28 AM
fs962d.html HTML File 16.8 KB Oct 2 2012 12:28 AM
fs962e.html HTML File 19.3 KB Oct 2 2012 12:29 AM
fs963a.html HTML File 18.3 KB Oct 2 2012 12:27 AM
fs963b.html HTML File 4.2 KB Oct 2 2012 12:33 AM
fs963c.html HTML File 14.3 KB Oct 2 2012 12:31 AM
fs963d.html HTML File 19.1 KB Oct 2 2012 12:28 AM
fs964a.html HTML File 22.4 KB Oct 2 2012 12:34 AM
fs964b.html HTML File 19.3 KB Oct 2 2012 12:28 AM
fs964c.html HTML File 3.1 KB Oct 2 2012 12:32 AM
fs964d.html HTML File 19.2 KB Oct 2 2012 12:31 AM
fs964e.html HTML File 18.3 KB Oct 2 2012 12:34 AM
fs965a.html HTML File 19.3 KB Oct 2 2012 12:29 AM
fs965b.html HTML File 15.1 KB Oct 2 2012 12:28 AM
fs965c.html HTML File 19.1 KB Oct 2 2012 12:31 AM
fs965d.html HTML File 16.3 KB Oct 2 2012 12:29 AM
fs965e.html HTML File 2.2 KB Oct 2 2012 12:30 AM
fs966a.html HTML File 15.7 KB Oct 2 2012 12:32 AM
fs966b.html HTML File 19.7 KB Oct 2 2012 12:28 AM
fs966c.html HTML File 15.9 KB Oct 2 2012 12:31 AM
fs966d.html HTML File 18.6 KB Oct 2 2012 12:29 AM
fs967a.html HTML File 20.5 KB Oct 2 2012 12:32 AM
fs967b.html HTML File 3.7 KB Oct 2 2012 12:31 AM
fs967c.html HTML File 18.9 KB Oct 2 2012 12:31 AM
fs967d.html HTML File 8.8 KB Oct 2 2012 12:33 AM
fs967e.html HTML File 18.8 KB Oct 2 2012 12:28 AM
fs967f.html HTML File 18.6 KB Oct 2 2012 12:31 AM
fs968a.html HTML File 17.7 KB Oct 2 2012 12:33 AM
fs968b.html HTML File 16.4 KB Oct 2 2012 12:27 AM
fs968c.html HTML File 19.1 KB Oct 2 2012 12:34 AM
fs968d.html HTML File 18 KB Oct 2 2012 12:33 AM
fs969a.html HTML File 17.1 KB Oct 2 2012 12:29 AM
fs969b.html HTML File 18.8 KB Oct 2 2012 12:32 AM
fs969c.html HTML File 19.9 KB Oct 2 2012 12:28 AM
fs969d.html HTML File 18.6 KB Oct 2 2012 12:28 AM
fs971a.html HTML File 17.7 KB Oct 2 2012 12:30 AM
fs971b.html HTML File 29.3 KB Oct 2 2012 12:29 AM
fs971c.html HTML File 17.3 KB Oct 2 2012 12:34 AM
fs972a.html HTML File 17.3 KB Oct 2 2012 12:32 AM
fs972b.html HTML File 17.1 KB Oct 2 2012 12:29 AM
fs972c.html HTML File 17.3 KB Oct 2 2012 12:31 AM
fs972d.html HTML File 17.7 KB Oct 2 2012 12:31 AM
fs973a.html HTML File 17.6 KB Oct 2 2012 12:30 AM
fs973b.html HTML File 18.5 KB Oct 2 2012 12:28 AM
fs973c.html HTML File 18.6 KB Oct 2 2012 12:29 AM
fs973d.html HTML File 15.8 KB Oct 2 2012 12:32 AM
fs974a.html HTML File 17.3 KB Oct 2 2012 12:31 AM
fs974b.html HTML File 17.2 KB Oct 2 2012 12:34 AM
fs974c.html HTML File 17.2 KB Oct 2 2012 12:32 AM
fs974d.html HTML File 17.8 KB Oct 2 2012 12:31 AM
fs975a.html HTML File 17.7 KB Oct 2 2012 12:31 AM
fs975b.html HTML File 18 KB Oct 2 2012 12:32 AM
fs975c.html HTML File 18.6 KB Oct 2 2012 12:27 AM
fs975d.html HTML File 17.6 KB Oct 2 2012 12:33 AM
fs976a.html HTML File 17.4 KB Oct 2 2012 12:30 AM
fs976b.html HTML File 17.2 KB Oct 2 2012 12:31 AM
fs976c.html HTML File 17 KB Oct 2 2012 12:27 AM
fs976d.html HTML File 17.7 KB Oct 2 2012 12:31 AM
fs977a.html HTML File 17.9 KB Oct 2 2012 12:32 AM
fs977b.html HTML File 17.6 KB Oct 2 2012 12:33 AM
fs977c.html HTML File 18.1 KB Oct 2 2012 12:28 AM
fs977d.html HTML File 17.5 KB Oct 2 2012 12:28 AM
fs978a.html HTML File 17.5 KB Oct 2 2012 12:31 AM
fs978b.html HTML File 17.1 KB Oct 2 2012 12:31 AM
fs978c.html HTML File 17.1 KB Oct 2 2012 12:33 AM
fs978d.html HTML File 17 KB Oct 2 2012 12:33 AM
fs979a.html HTML File 17.3 KB Oct 2 2012 12:34 AM
fs979b.html HTML File 18 KB Oct 2 2012 12:32 AM
fs979c.html HTML File 17.4 KB Oct 2 2012 12:28 AM
fs979d.html HTML File 17.4 KB Oct 2 2012 12:33 AM
fs981a.html HTML File 16.9 KB Oct 2 2012 12:31 AM
fs981b.html HTML File 16.7 KB Oct 2 2012 12:31 AM
fs981c.html HTML File 17.2 KB Oct 2 2012 12:32 AM
fs981d.html HTML File 17.9 KB Oct 2 2012 12:31 AM
fs982a.html HTML File 18.2 KB Oct 2 2012 12:34 AM
fs982b.html HTML File 17.8 KB Oct 2 2012 12:32 AM
fs982c.html HTML File 17.1 KB Oct 2 2012 12:33 AM
fs982d.html HTML File 16.8 KB Oct 2 2012 12:29 AM
fs983a.html HTML File 16.3 KB Oct 2 2012 12:32 AM
fs983b.html HTML File 18.3 KB Oct 2 2012 12:31 AM
fs983c.html HTML File 18.1 KB Oct 2 2012 12:33 AM
fs983d.html HTML File 17.4 KB Oct 2 2012 12:32 AM
fs984a.html HTML File 17.1 KB Oct 2 2012 12:31 AM
fs984b.html HTML File 17.5 KB Oct 2 2012 12:29 AM
fs984c.html HTML File 18.4 KB Oct 2 2012 12:31 AM
fs984d.html HTML File 17 KB Oct 2 2012 12:30 AM
fs985a.html HTML File 18.4 KB Oct 2 2012 12:31 AM
fs985b.html HTML File 18 KB Oct 2 2012 12:28 AM
fs985c.html HTML File 17.4 KB Oct 2 2012 12:33 AM
fs985d.html HTML File 17.2 KB Oct 2 2012 12:29 AM
fs986a.html HTML File 18.3 KB Oct 2 2012 12:34 AM
fs986b.html HTML File 18.2 KB Oct 2 2012 12:28 AM
fs986c.html HTML File 16.8 KB Oct 2 2012 12:33 AM
fs986d.html HTML File 18.5 KB Oct 2 2012 12:32 AM
fs987a.html HTML File 18.4 KB Oct 2 2012 12:30 AM
fs987b.html HTML File 17.1 KB Oct 2 2012 12:31 AM
fs987c.html HTML File 18.9 KB Oct 2 2012 12:30 AM
fs987d.html HTML File 18.8 KB Oct 2 2012 12:33 AM
fs988a.html HTML File 17.7 KB Oct 2 2012 12:32 AM
fs988b.html HTML File 17.1 KB Oct 2 2012 12:27 AM
fs988c.html HTML File 17.7 KB Oct 2 2012 12:31 AM
fs988d.html HTML File 19.3 KB Oct 2 2012 12:31 AM
fs989a.html HTML File 18.5 KB Oct 2 2012 12:27 AM
fs989b.html HTML File 18.8 KB Oct 2 2012 12:28 AM
fs989c.html HTML File 20 KB Oct 2 2012 12:28 AM
fs989d.html HTML File 19.8 KB Oct 2 2012 12:30 AM
fs991a.html HTML File 20.2 KB Oct 2 2012 12:29 AM
fs991b.html HTML File 19.1 KB Oct 2 2012 12:31 AM
fs991c.html HTML File 20.3 KB Oct 2 2012 12:27 AM
fs991d.html HTML File 19.9 KB Oct 2 2012 12:29 AM
fs992a.html HTML File 20.4 KB Oct 2 2012 12:31 AM
fs992b.html HTML File 20.3 KB Oct 2 2012 12:32 AM
fs992c.html HTML File 19.8 KB Oct 2 2012 12:28 AM
fs992d.html HTML File 19.9 KB Oct 2 2012 12:32 AM
fs993a.html HTML File 19.7 KB Oct 2 2012 12:29 AM
fs993b.html HTML File 19.4 KB Oct 2 2012 12:28 AM
fs993c.html HTML File 20.3 KB Oct 2 2012 12:34 AM
fs993d.html HTML File 20 KB Oct 2 2012 12:33 AM
fs994a.html HTML File 20 KB Oct 2 2012 12:32 AM
fs994b.html HTML File 19.6 KB Oct 2 2012 12:31 AM
fs994c.html HTML File 19.8 KB Oct 2 2012 12:31 AM
fs994d.html HTML File 19.5 KB Oct 2 2012 12:31 AM
fs995a.html HTML File 19.5 KB Oct 2 2012 12:27 AM
fs995b.html HTML File 20.1 KB Oct 2 2012 12:34 AM
fs995c.html HTML File 19.5 KB Oct 2 2012 12:31 AM
fs995d.html HTML File 19.1 KB Oct 2 2012 12:31 AM
fs996a.html HTML File 19.6 KB Oct 2 2012 12:32 AM
fs996b.html HTML File 19.3 KB Oct 2 2012 12:33 AM
fs996c.html HTML File 19.8 KB Oct 2 2012 12:32 AM
fs996d.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs997a.html HTML File 19.9 KB Oct 2 2012 12:28 AM
fs997b.html HTML File 20 KB Oct 2 2012 12:30 AM
fs997c.html HTML File 19.7 KB Oct 2 2012 12:30 AM
fs997d.html HTML File 19.8 KB Oct 2 2012 12:32 AM
fs998a.html HTML File 19.7 KB Oct 2 2012 12:31 AM
fs998b.html HTML File 19.8 KB Oct 2 2012 12:31 AM
fs998c.html HTML File 20 KB Oct 2 2012 12:32 AM
fs998d.html HTML File 19.7 KB Oct 2 2012 12:30 AM
fs999a.html HTML File 19.7 KB Oct 2 2012 12:30 AM
fs999b.html HTML File 19.4 KB Oct 2 2012 12:29 AM
fs999c.html HTML File 20 KB Oct 2 2012 12:33 AM
fs999d.html HTML File 20.1 KB Oct 2 2012 12:30 AM
fs9510a.html HTML File 18.5 KB Oct 2 2012 12:33 AM
fs9510b.html HTML File 18.3 KB Oct 2 2012 12:27 AM
fs9511a.html HTML File 18.6 KB Oct 2 2012 12:34 AM
fs9511c.html HTML File 55.8 KB Oct 2 2012 12:31 AM
fs9511d.html HTML File 18.9 KB Oct 2 2012 12:28 AM
fs9512a.html HTML File 17.9 KB Oct 2 2012 12:33 AM
fs9512b.html HTML File 12.6 KB Oct 2 2012 12:31 AM
fs9512c.html HTML File 7.9 KB Oct 2 2012 12:33 AM
fs9512d.html HTML File 16.4 KB Oct 2 2012 12:34 AM
fs9611a.html HTML File 13.2 KB Oct 2 2012 12:31 AM
fs9611b.html HTML File 18.6 KB Oct 2 2012 12:29 AM
fs9611c.html HTML File 18.4 KB Oct 2 2012 12:27 AM
fs9611d.html HTML File 13.8 KB Oct 2 2012 12:31 AM
fs9612a.html HTML File 61.9 KB Oct 2 2012 12:28 AM
fs9710a.html HTML File 16.7 KB Oct 2 2012 12:30 AM
fs9710b.html HTML File 17.1 KB Oct 2 2012 12:27 AM
fs9710c.html HTML File 17.7 KB Oct 2 2012 12:32 AM
fs9710d.html HTML File 16.4 KB Oct 2 2012 12:30 AM
fs9711a.html HTML File 17.8 KB Oct 2 2012 12:31 AM
fs9711b.html HTML File 18.3 KB Oct 2 2012 12:28 AM
fs9711c.html HTML File 17.2 KB Oct 2 2012 12:30 AM
fs9711d.html HTML File 17.6 KB Oct 2 2012 12:31 AM
fs9712a.html HTML File 18 KB Oct 2 2012 12:31 AM
fs9712b.html HTML File 17.3 KB Oct 2 2012 12:32 AM
fs9712c.html HTML File 17.4 KB Oct 2 2012 12:28 AM
fs9712d.html HTML File 18 KB Oct 2 2012 12:28 AM
fs9810a.html HTML File 19.7 KB Oct 2 2012 12:32 AM
fs9810b.html HTML File 20 KB Oct 2 2012 12:31 AM
fs9810c.html HTML File 20.3 KB Oct 2 2012 12:31 AM
fs9810d.html HTML File 20 KB Oct 2 2012 12:33 AM
fs9811a.html HTML File 19.9 KB Oct 2 2012 12:31 AM
fs9811b.html HTML File 20.3 KB Oct 2 2012 12:27 AM
fs9811c.html HTML File 19.9 KB Oct 2 2012 12:29 AM
fs9811d.html HTML File 19.6 KB Oct 2 2012 12:31 AM
fs9812a.html HTML File 19.9 KB Oct 2 2012 12:31 AM
fs9812b.html HTML File 19.9 KB Oct 2 2012 12:28 AM
fs9812c.html HTML File 19.9 KB Oct 2 2012 12:33 AM
fs9812d.html HTML File 19.6 KB Oct 2 2012 12:33 AM
fs9910a.html HTML File 19.9 KB Oct 2 2012 12:31 AM
fs9910b.html HTML File 20.2 KB Oct 2 2012 12:30 AM
fs9910c.html HTML File 20.1 KB Oct 2 2012 12:30 AM
fs9910d.html HTML File 19.8 KB Oct 2 2012 12:27 AM
fs9911a.html HTML File 19.9 KB Oct 2 2012 12:31 AM
fs9911b.html HTML File 19.2 KB Oct 2 2012 12:27 AM
fs9911c.html HTML File 19.9 KB Oct 2 2012 12:29 AM
fs9911d.html HTML File 20.2 KB Oct 2 2012 12:31 AM
fs9912a.html HTML File 20 KB Oct 2 2012 12:31 AM
fs9912b.html HTML File 20.1 KB Oct 2 2012 12:27 AM
fs9912c.html HTML File 19 KB Oct 2 2012 12:31 AM
fs9912d.html HTML File 19.3 KB Oct 2 2012 12:33 AM
Full Text of Ahmadinejad's Letter to Merkel.htm HTML File 19.3 KB Oct 2 2012 12:28 AM
futureofman.pdf PDF Document 1.5 MB Oct 2 2012 12:27 AM
ga-1-73.pdf PDF Document 16.3 MB Oct 2 2012 12:31 AM
galileeflowers.pdf PDF Document 2.3 MB Oct 2 2012 12:33 AM
galileeflowers.rtf RTF File 1.1 MB Oct 2 2012 12:28 AM
GasChamberExecution.pdf PDF Document 39.9 KB Oct 2 2012 12:33 AM
gas_prices.pdf PDF Document 164.6 KB Oct 2 2012 12:33 AM
Genes Trace the Ancient Wanderings of White People.htm HTML File 7.8 KB Oct 2 2012 12:31 AM
Genetic Branching - Keep it Going.htm HTML File 13.4 KB Oct 2 2012 12:29 AM
George Orwell - 1984.pdf PDF Document 564.4 KB Oct 2 2012 12:31 AM
GermanLawAndLegislation.pdf PDF Document 64.6 KB Oct 2 2012 12:34 AM
GermanLawAndLegislation.rtf RTF File 88.2 KB Oct 2 2012 12:27 AM
German Politicians Talk Turkey.htm HTML File 2.6 KB Oct 2 2012 12:32 AM
Germany - PC Gift to Patriots.htm HTML File 2.9 KB Oct 2 2012 12:33 AM
getreadyforthecomingconflictwithchina.html HTML File 6 KB Oct 2 2012 12:33 AM
GFactor.pdf PDF Document 722.2 KB Oct 2 2012 12:32 AM
Giant.pdf PDF Document 1.4 MB Oct 2 2012 12:31 AM
gibson.pdf PDF Document 591.9 KB Oct 2 2012 12:28 AM
gibson_wm_docs_072806.pdf PDF Document 248.1 KB Oct 2 2012 12:31 AM
Give Them Lead, Not Silver.htm HTML File 3 KB Oct 2 2012 12:33 AM
God, Religion, and Tribal Conflict.htm HTML File 30.2 KB Oct 2 2012 12:28 AM
Goebbels.pdf PDF Document 2.9 MB Oct 2 2012 12:31 AM
Goering.pdf PDF Document 3.8 MB Oct 2 2012 12:31 AM
good_jewbad_jew_paradigm - The Mindset that Impedes Civilization's Healing Process.htm HTML File 26.1 KB Oct 2 2012 12:31 AM
Governor Schwarzenegger's Statement Denying Tookie Clemency.htm HTML File 12.4 KB Oct 2 2012 12:30 AM
grafmemoir.pdf PDF Document 153.1 KB Oct 2 2012 12:28 AM
grafmemoir.rtf RTF File 194.8 KB Oct 2 2012 12:29 AM
Gramage's DVD copying guide - v2 .rtf RTF File 16.3 KB Oct 2 2012 12:34 AM
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust.htm HTML File 13.4 KB Oct 2 2012 12:32 AM
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust.txt Text File 11.7 KB Oct 2 2012 12:34 AM
Guazzo.html HTML File 10 KB Oct 2 2012 12:28 AM
Guilt March Hosts Named For Plagiarist.htm HTML File 5.8 KB Oct 2 2012 12:27 AM
guilty.pdf PDF Document 55.4 KB Oct 2 2012 12:28 AM
gulag.html HTML File 3.1 KB Oct 2 2012 12:32 AM
Guts - A White Man Who Won't Back Down.htm HTML File 4.3 KB Oct 2 2012 12:32 AM
Guy Ritchie - Kabbalah Ruined My Film.htm HTML File 4.1 KB Oct 2 2012 12:30 AM
H067172052X.zip ZIP Archive 398.5 KB Oct 2 2012 12:28 AM
Half of Katrina Refugees Are Criminals.htm HTML File 3.6 KB Oct 2 2012 12:29 AM
halfofprisonersareblack.html HTML File 4.6 KB Oct 2 2012 12:31 AM
hans.pdf PDF Document 62.6 KB Oct 2 2012 12:33 AM
Hans Christian Andersen (1845) - Holger Danske.htm HTML File 11.4 KB Oct 2 2012 12:29 AM
Happy German-American Day.htm HTML File 3.4 KB Oct 2 2012 12:29 AM
Harold A. Covington - A Distant Thunder.doc Microsoft Word Document 1.3 MB Oct 2 2012 12:34 AM
Has King Tut Been 'Whitewashed'.htm HTML File 2.5 KB Oct 2 2012 12:27 AM
hate crime.pdf PDF Document 408.8 KB Oct 2 2012 12:33 AM
hatecrimespamphlet.pdf PDF Document 62.2 KB Oct 2 2012 12:30 AM
hatedir.pdf PDF Document 1 MB Oct 2 2012 12:31 AM
hate directory.pdf PDF Document 392.4 KB Oct 2 2012 12:31 AM
Head of Homeland Security Has Ties With Suspected Financier of 911.htm HTML File 2 KB Oct 2 2012 12:31 AM
Heather Mac Donald on Immigration on National Review Online - A Latin conservative tidal wave is not coming.htm HTML File 8 KB Oct 2 2012 12:33 AM
he Jewish Conquest of the World.htm HTML File 71.3 KB Oct 2 2012 12:30 AM
Henry David Thoreau - Civil Disobedience.pdf PDF Document 87.8 KB Oct 2 2012 12:28 AM
Henry Ford - 1922-01-07 - Candid Address to Jews on the Jewish Problem.htm HTML File 29.3 KB Oct 2 2012 12:30 AM
Henry Kissinger - The Walking, Talking Conflict of Interest.htm HTML File 22.4 KB Oct 2 2012 12:33 AM
Hess.pdf PDF Document 2.1 MB Oct 2 2012 12:31 AM
hey're Not All Bad...Are They.htm HTML File 9.6 KB Oct 2 2012 12:28 AM
hey_you.pdf PDF Document 121 KB Oct 2 2012 12:31 AM
Hezbollah Broke Israeli Codes.htm HTML File 3.2 KB Oct 2 2012 12:34 AM
hidden.html HTML File 12.7 KB Oct 2 2012 12:31 AM
HighCostOfVengeance.pdf PDF Document 212.3 KB Oct 2 2012 12:33 AM
High School Failure Rate Highest in Non-White Districts.htm HTML File 3.3 KB Oct 2 2012 12:28 AM
Hilarious PC Language Lesson.htm HTML File 4 KB Oct 2 2012 12:28 AM
HILLARY, TORRICELLI DONOR'S FUNNY MONEY Port's New Head, Sued by Brother, Faces an Inquiry.htm HTML File 62 KB Oct 2 2012 12:31 AM
Himmelfarb.pdf PDF Document 122.3 KB Oct 2 2012 12:32 AM
HispanicsReport.pdf PDF Document 985.5 KB Oct 2 2012 12:29 AM
Historical Myth Justifies Golan Heights Occupation.htm HTML File 5.5 KB Oct 2 2012 12:28 AM
history.html HTML File 51 KB Oct 2 2012 12:33 AM
History of the Original Ku Klux Klan.txt Text File 47.1 KB Oct 2 2012 12:31 AM
histwiz 1.pdf PDF Document 8.7 MB Oct 2 2012 12:34 AM
histwiz 2.pdf PDF Document 1.8 MB Oct 2 2012 12:28 AM
histwiz 3.pdf PDF Document 1.7 MB Oct 2 2012 12:33 AM
histwiz 4.pdf PDF Document 159.3 KB Oct 2 2012 12:29 AM
HitlerLifeOfALeader.pdf PDF Document 6.1 MB Oct 2 2012 12:31 AM
HitlerWeLovedAndWhy.rtf RTF File 88.6 KB Oct 2 2012 12:31 AM
H Millard - Homeless Jack on Iran, Freedom, Intellectuals, and the Holocaust.htm HTML File 12.7 KB Oct 2 2012 12:31 AM
Hmong Immigrant Commits Mass Murder in Northern Wisconsin.htm HTML File 5.7 KB Oct 2 2012 12:31 AM
hoax.pdf PDF Document 12.9 MB Oct 2 2012 12:33 AM
hoax.rtf RTF File 16.4 MB Oct 2 2012 12:33 AM
hoax.zip ZIP Archive 2.3 MB Oct 2 2012 12:32 AM
hoax2.pdf PDF Document 1.2 MB Oct 2 2012 12:31 AM
Hockney's Secret Knowledge - Refuted.htm HTML File 2.5 KB Oct 2 2012 12:33 AM
Holger Dansk - Denmark's Mountain King.htm HTML File 19.5 KB Oct 2 2012 12:31 AM
holindustry.pdf PDF Document 554.2 KB Oct 2 2012 12:31 AM
holindustry.rtf RTF File 5.3 MB Oct 2 2012 12:33 AM
HollyhoaxMadeInRussia.pdf PDF Document 17.8 MB Oct 2 2012 12:30 AM
Hollywood Slanders Italian Americans.htm HTML File 4.3 KB Oct 2 2012 12:28 AM
Holo-Jokes.pdf PDF Document 53.9 KB Oct 2 2012 12:33 AM
HolocaustDenial2005.pdf PDF Document 259.4 KB Oct 2 2012 12:32 AM
Holocaust Fraud.htm HTML File 13.2 KB Oct 2 2012 12:31 AM
Holocaust Hoax to be Hammered at Upcoming Conference in Iran.htm HTML File 6.7 KB Oct 2 2012 12:30 AM
Holocaust Lawyer Faces $3.2 Million Malpractice Judgment.htm HTML File 2.6 KB Oct 2 2012 12:33 AM
holocaustorhoax.pdf PDF Document 990.4 KB Oct 2 2012 12:34 AM
holocaustorhoax.rtf RTF File 605.3 KB Oct 2 2012 12:31 AM
HolyBookOfAdolfHitler.pdf PDF Document 141.1 KB Oct 2 2012 12:30 AM
HolyBookOfAdolfHitler.rtf RTF File 186.6 KB Oct 2 2012 12:33 AM
Homeland Security's Casualties.htm HTML File 6.8 KB Oct 2 2012 12:30 AM
Homeland Security Nominee Chertoff Aided 9-11 Terror Suspect.htm HTML File 17.4 KB Oct 2 2012 12:34 AM
Homeless Jack Offers a Primer.htm HTML File 13.3 KB Oct 2 2012 12:28 AM
Homeless Jack on New Orleans.htm HTML File 8.3 KB Oct 2 2012 12:32 AM
Home on the Range.htm HTML File 6.9 KB Oct 2 2012 12:31 AM
Homosexual Groups Trying to Distance Themselves From Foley.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
Honest Money.pdf PDF Document 225 KB Oct 2 2012 12:33 AM
Honoring Robert E. Lee.htm HTML File 10.7 KB Oct 2 2012 12:31 AM
Houston - Turf War Breaks Out between Katrina Refugees, Locals.htm HTML File 3.2 KB Oct 2 2012 12:33 AM
How a Non-White Country Treats Asylum Invaders.htm HTML File 6.1 KB Oct 2 2012 12:30 AM
How Many More Nations Will Israel Attack.htm HTML File 10.3 KB Oct 2 2012 12:34 AM
How Many Tanks Did Israel Lose.htm HTML File 5 KB Oct 2 2012 12:28 AM
How Muslims Deal With Third World Immigrants.htm HTML File 2.9 KB Oct 2 2012 12:27 AM
How New Orleans Was Lost.htm HTML File 3 KB Oct 2 2012 12:33 AM
How Small Genetic Differences Give Racial Divergency.htm HTML File 21.1 KB Oct 2 2012 12:28 AM
How To Burn Bootable Disks & Install OS X from External Volumes.rtf RTF File 13.9 KB Oct 2 2012 12:30 AM
How to Crack CD Protections.pdf PDF Document 30 KB Oct 2 2012 12:31 AM
How to Develop Super Power Memory.pdf PDF Document 2.5 MB Oct 2 2012 12:31 AM
How to rebuild a Li-Ion pack.pdf PDF Document 1.6 MB Oct 2 2012 12:33 AM
How Unskilled Immigrants Hurt Our Economy.htm HTML File 3.7 KB Oct 2 2012 12:33 AM
hsb.pdf PDF Document 442.9 KB Oct 2 2012 12:28 AM
hsb.rtf RTF File 1.2 MB Oct 2 2012 12:29 AM
hsb.zip ZIP Archive 205.4 KB Oct 2 2012 12:30 AM
htpt.pdf PDF Document 864.7 KB Oct 2 2012 12:28 AM
htpt.rtf RTF File 473.6 KB Oct 2 2012 12:34 AM
http__www.hartford-hwp.com_cp-usa.html HTML File 1.9 KB Oct 2 2012 12:31 AM
Hueng Metal Hydrides BCC 033003.pdf PDF Document 898.9 KB Oct 2 2012 12:28 AM
Hugo Chavez - Rise Up Against the Empire.htm HTML File 18.3 KB Oct 2 2012 12:27 AM
human_shields.pdf PDF Document 471.2 KB Oct 2 2012 12:28 AM
humor.html HTML File 21.7 KB Oct 2 2012 12:31 AM
hunter.css Stylesheet 503 Bytes Oct 2 2012 12:28 AM
Hunter.pdf PDF Document 1.1 MB Oct 2 2012 12:33 AM
Hurricane Katrina - Blacks Worsen Disaster.htm HTML File 5.7 KB Oct 2 2012 12:33 AM
Hurricane Katrina and Black Behavior.htm HTML File 4.7 KB Oct 2 2012 12:29 AM
Hurricane Katrina Devastates Duke Headquarters.htm HTML File 6.1 KB Oct 2 2012 12:33 AM
Hurricane Tracking Chart - Atlantic Basin.pdf PDF Document 107.8 KB Oct 2 2012 12:28 AM
Hurricane Tracking Chart - Atlantic Basin West.pdf PDF Document 906.4 KB Oct 2 2012 12:31 AM
Hurricane Tracking Chart - East Pacific.pdf PDF Document 289.3 KB Oct 2 2012 12:33 AM
Hushed-up Israeli Spy Operations against USA and Mexico 2000 - 2003.htm HTML File 34.1 KB Oct 2 2012 12:28 AM
HW1.pdf PDF Document 3.6 MB Oct 2 2012 12:31 AM
hwr60.htm HTML File 35.5 KB Oct 2 2012 12:28 AM
hwr61.htm HTML File 10 KB Oct 2 2012 12:32 AM
HWT-Brizahpage.PDF PDF Document 452.4 KB Oct 2 2012 12:30 AM
HW_Web.pdf PDF Document 3.9 MB Oct 2 2012 12:28 AM
HW_Web_dl.pdf PDF Document 4.6 MB Oct 2 2012 12:27 AM
IfanAgentKnocks.pdf PDF Document 17 KB Oct 2 2012 12:34 AM
If You Tolerate This....htm HTML File 16.8 KB Oct 2 2012 12:28 AM
Igniting the Spark - An Interview With David Duke.htm HTML File 30.5 KB Oct 2 2012 12:29 AM
IHRLeaflets.pdf PDF Document 284.6 KB Oct 2 2012 12:28 AM
IHRupdate_November_2005.pdf PDF Document 1.5 MB Oct 2 2012 12:30 AM
ij01.html HTML File 32.3 KB Oct 2 2012 12:28 AM
ij02.html HTML File 19.7 KB Oct 2 2012 12:28 AM
ij03.html HTML File 20.7 KB Oct 2 2012 12:32 AM
ij04.html HTML File 24.3 KB Oct 2 2012 12:33 AM
ij05.html HTML File 29.5 KB Oct 2 2012 12:27 AM
ij06.html HTML File 15.6 KB Oct 2 2012 12:31 AM
ij07.html HTML File 17.4 KB Oct 2 2012 12:28 AM
ij08.html HTML File 24.9 KB Oct 2 2012 12:28 AM
ij09.html HTML File 26.8 KB Oct 2 2012 12:33 AM
ij10.html HTML File 17.7 KB Oct 2 2012 12:29 AM
ij11.html HTML File 25.1 KB Oct 2 2012 12:33 AM
ij12.html HTML File 26.2 KB Oct 2 2012 12:28 AM
ij13.html HTML File 26.2 KB Oct 2 2012 12:32 AM
ij14.html HTML File 23 KB Oct 2 2012 12:28 AM
ij15.html HTML File 25.6 KB Oct 2 2012 12:32 AM
ij16.html HTML File 26.2 KB Oct 2 2012 12:31 AM
ij17.html HTML File 31 KB Oct 2 2012 12:29 AM
ij18.html HTML File 23.8 KB Oct 2 2012 12:28 AM
ij19.html HTML File 24.3 KB Oct 2 2012 12:29 AM
ij20.html HTML File 24.8 KB Oct 2 2012 12:30 AM
ij21.html HTML File 24.8 KB Oct 2 2012 12:28 AM
ij22.html HTML File 24.1 KB Oct 2 2012 12:33 AM
ij23.html HTML File 25.1 KB Oct 2 2012 12:32 AM
ij24.html HTML File 25.5 KB Oct 2 2012 12:27 AM
ij25.html HTML File 24.1 KB Oct 2 2012 12:28 AM
ij26.html HTML File 21.5 KB Oct 2 2012 12:31 AM
ij27.html HTML File 25.7 KB Oct 2 2012 12:30 AM
ij28.html HTML File 22.7 KB Oct 2 2012 12:31 AM
ij29.html HTML File 16.9 KB Oct 2 2012 12:30 AM
ij30.html HTML File 20.1 KB Oct 2 2012 12:31 AM
ij31.html HTML File 21.3 KB Oct 2 2012 12:28 AM
ij32.html HTML File 22.1 KB Oct 2 2012 12:32 AM
ij33.html HTML File 24.9 KB Oct 2 2012 12:33 AM
ij34.html HTML File 24.2 KB Oct 2 2012 12:29 AM
ij35.html HTML File 28.1 KB Oct 2 2012 12:31 AM
ij36.html HTML File 25.4 KB Oct 2 2012 12:29 AM
ij37.html HTML File 4.5 KB Oct 2 2012 12:31 AM
ij38.html HTML File 15.9 KB Oct 2 2012 12:33 AM
ij39.html HTML File 7.5 KB Oct 2 2012 12:33 AM
ij40.html HTML File 25.9 KB Oct 2 2012 12:30 AM
ij41.html HTML File 26.8 KB Oct 2 2012 12:31 AM
ij42.html HTML File 25.2 KB Oct 2 2012 12:31 AM
ij43.html HTML File 28 KB Oct 2 2012 12:33 AM
ij44.html HTML File 29.7 KB Oct 2 2012 12:30 AM
ij45.html HTML File 29 KB Oct 2 2012 12:31 AM
ij46.html HTML File 26.3 KB Oct 2 2012 12:29 AM
ij47.html HTML File 22.8 KB Oct 2 2012 12:33 AM
ij48.html HTML File 26.6 KB Oct 2 2012 12:33 AM
ij49.html HTML File 26.8 KB Oct 2 2012 12:32 AM
ij50.html HTML File 23.5 KB Oct 2 2012 12:31 AM
ij51.html HTML File 27.9 KB Oct 2 2012 12:30 AM
ij52.html HTML File 25.6 KB Oct 2 2012 12:31 AM
ij53.html HTML File 25.9 KB Oct 2 2012 12:32 AM
ij54.html HTML File 24.7 KB Oct 2 2012 12:31 AM
ij55.html HTML File 24.3 KB Oct 2 2012 12:33 AM
ij56.html HTML File 23.8 KB Oct 2 2012 12:31 AM
ij57.html HTML File 26.3 KB Oct 2 2012 12:27 AM
ij58.html HTML File 25.4 KB Oct 2 2012 12:33 AM
ij59.html HTML File 24.6 KB Oct 2 2012 12:33 AM
ij60.html HTML File 26.1 KB Oct 2 2012 12:28 AM
ij61.html HTML File 27.6 KB Oct 2 2012 12:28 AM
ij62.html HTML File 25.2 KB Oct 2 2012 12:31 AM
ij63.html HTML File 24.6 KB Oct 2 2012 12:31 AM
ij64.html HTML File 20.6 KB Oct 2 2012 12:33 AM
ij65.html HTML File 26.2 KB Oct 2 2012 12:33 AM
ij66.html HTML File 26.5 KB Oct 2 2012 12:28 AM
ij67.html HTML File 27.3 KB Oct 2 2012 12:33 AM
ij68.html HTML File 27.6 KB Oct 2 2012 12:28 AM
ij69.html HTML File 28 KB Oct 2 2012 12:31 AM
ij70.html HTML File 23.6 KB Oct 2 2012 12:33 AM
ij71.html HTML File 23.9 KB Oct 2 2012 12:28 AM
ij72.html HTML File 21.1 KB Oct 2 2012 12:32 AM
ij73.html HTML File 25.3 KB Oct 2 2012 12:30 AM
ij74.html HTML File 22 KB Oct 2 2012 12:30 AM
ij75.html HTML File 25.3 KB Oct 2 2012 12:34 AM
ij76.html HTML File 26 KB Oct 2 2012 12:30 AM
ij77.html HTML File 29.2 KB Oct 2 2012 12:30 AM
ij78.html HTML File 29.2 KB Oct 2 2012 12:31 AM
ij79.html HTML File 23.7 KB Oct 2 2012 12:34 AM
ij80.html HTML File 24.3 KB Oct 2 2012 12:34 AM
Illegal Immigration - War with Mexico Approaches.htm HTML File 3.2 KB Oct 2 2012 12:28 AM
Illegal Immigration and the Racism of 'Antiracism'.htm HTML File 15.8 KB Oct 2 2012 12:31 AM
IllegalImmigrationMyths.pdf PDF Document 75.3 KB Oct 2 2012 12:34 AM
Illegal Immigration Sparks Race War in Cities, Prisions.htm HTML File 7.8 KB Oct 2 2012 12:30 AM
Illegals Demand the 'Right' to Break the Law.htm HTML File 6.7 KB Oct 2 2012 12:33 AM
Illinois Cops - Arabs Beat, Gas Black.htm HTML File 4 KB Oct 2 2012 12:27 AM
immigrationmustcease.pdf PDF Document 109.7 KB Oct 2 2012 12:32 AM
imperium-pdf.zip ZIP Archive 1.3 MB Oct 2 2012 12:28 AM
imperium.css Stylesheet 758 Bytes Oct 2 2012 12:32 AM
imperium.zip ZIP Archive 510.3 KB Oct 2 2012 12:29 AM
Imperium103.pdf PDF Document 1.2 MB Oct 2 2012 12:30 AM
InDefenseOfRacism.pdf PDF Document 288 KB Oct 2 2012 12:32 AM
indexfiles.html HTML File 15 KB Oct 2 2012 12:27 AM
Indian Schools, Genes, Assimilation, and Illegal Aliens.htm HTML File 15.9 KB Oct 2 2012 12:33 AM
Indians Reject Black Claims.htm HTML File 6.3 KB Oct 2 2012 12:31 AM
Indicted - Republican Corporate Whore DeLay Resigns.htm HTML File 4.1 KB Oct 2 2012 12:31 AM
infamy.pdf PDF Document 313.3 KB Oct 2 2012 12:31 AM
Infected Africans Skyrocket AIDS-HIV in Croydon, London.htm HTML File 1.8 KB Oct 2 2012 12:31 AM
In Italy, Al Qaeda Turns to Organized Crime for Protection.htm HTML File 3.7 KB Oct 2 2012 12:31 AM
In Praise of Saudi Arabia.htm HTML File 4.8 KB Oct 2 2012 12:28 AM
Institute for Political & International Studies.htm HTML File 17 KB Oct 2 2012 12:32 AM
InternationalJew.pdf PDF Document 3.1 MB Oct 2 2012 12:29 AM
InternationalJew.rtf RTF File 2.2 MB Oct 2 2012 12:29 AM
Interracial Rape Victim - Called by God to 'Minister Against Racism'.htm HTML File 7.2 KB Oct 2 2012 12:28 AM
Interview with the Grim Reaper - StantonReaper0905.htm HTML File 16.8 KB Oct 2 2012 12:32 AM
intro - National Vanguard.pdf PDF Document 1.4 MB Oct 2 2012 12:32 AM
Intro.htm HTML File 17.1 KB Oct 2 2012 12:28 AM
intro.pdf PDF Document 1.4 MB Oct 2 2012 12:29 AM
Introducing the Global I.D. Card.htm HTML File 2 KB Oct 2 2012 12:31 AM
introduction.html HTML File 9.2 KB Oct 2 2012 12:34 AM
Invasion.pdf PDF Document 27 KB Oct 2 2012 12:33 AM
Iran - The 'Holocaust' Threat to World Peace.htm HTML File 22.3 KB Oct 2 2012 12:34 AM
Iranians Produce Holocaust Cartoons.htm HTML File 5 KB Oct 2 2012 12:32 AM
Iraq - Christians Leery of Islamic 'Tolerance'.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
Iraq at the Gates of Hell.htm HTML File 37.8 KB Oct 2 2012 12:32 AM
IraqGassingLies.pdf PDF Document 81.1 KB Oct 2 2012 12:30 AM
Iraqi Resister - Black Soldiers are Targets.htm HTML File 4.6 KB Oct 2 2012 12:31 AM
irish.pdf PDF Document 1.3 MB Oct 2 2012 12:27 AM
Irish Academics Urge Israel Boycott.htm HTML File 3.5 KB Oct 2 2012 12:31 AM
IronHeel.pdf PDF Document 557.4 KB Oct 2 2012 12:28 AM
Irreconcilable Differences.htm HTML File 152.5 KB Oct 2 2012 12:32 AM
irving.html HTML File 24.9 KB Oct 2 2012 12:34 AM
Is any of this stuff made in Israel.htm HTML File 30.7 KB Oct 2 2012 12:28 AM
Is Europe Unable to Assimilate Its Growing Islamic Minority.htm HTML File 10.8 KB Oct 2 2012 12:30 AM
Islamic Headscarf Ban Debate Hits Australia.htm HTML File 3.3 KB Oct 2 2012 12:31 AM
Islamic Wisdom - 'Rapist' Jailed, 'Victim' Executed.htm HTML File 2.4 KB Oct 2 2012 12:27 AM
Islamists Throng in Europe's Powder Keg.htm HTML File 3.2 KB Oct 2 2012 12:33 AM
Islam versus Christianity – A reply to The Pope!.htm HTML File 58.8 KB Oct 2 2012 12:33 AM
Is Neocon Spokesman Soliciting Murder of David Duke.htm HTML File 6.9 KB Oct 2 2012 12:32 AM
Israel's End Game Gambit Failure_ Hamas Refuses to Allow Israel to Exist.html HTML File 63.2 KB Oct 2 2012 12:32 AM
Israel's Interior Minister - 'Stop Spitting on Christians'.htm HTML File 8 KB Oct 2 2012 12:29 AM
Israel's Secret Weapon.htm HTML File 43 KB Oct 2 2012 12:33 AM
Israel's Sex-Slave Industry Soars.htm HTML File 2.9 KB Oct 2 2012 12:28 AM
Israel - Beyond Good and Evil.htm HTML File 5.7 KB Oct 2 2012 12:27 AM
Israel - New Party Urges Expulsion of Non-Jews.htm HTML File 3.6 KB Oct 2 2012 12:32 AM
Israel - Poll Shows 64 Percent of Israeli Jews Favor Ethnic Cleansing.htm HTML File 3.2 KB Oct 2 2012 12:29 AM
Israel - Was BBC's Peter Hounam Arrested as Punishment.htm HTML File 4.7 KB Oct 2 2012 12:33 AM
israel.pdf PDF Document 531.8 KB Oct 2 2012 12:30 AM
Israel Honors Jewish Terrorists Who Attacked America.htm HTML File 17.3 KB Oct 2 2012 12:31 AM
Israeli-Sponsored Educational Program for NY Schools.htm HTML File 2.5 KB Oct 2 2012 12:31 AM
israeliespionageandillegaltechnologyretransfer.html HTML File 11.1 KB Oct 2 2012 12:27 AM
Israeli Gangster Shot Dead in Russia.htm HTML File 2.5 KB Oct 2 2012 12:28 AM
Israeli Minister Calls for Nasrallah's Death.htm HTML File 2.7 KB Oct 2 2012 12:33 AM
Israel in Hot Water Over New Zealand Spies.htm HTML File 3.9 KB Oct 2 2012 12:28 AM
Israeli Nuclear Whistleblower Vanunu Speaks.htm HTML File 3.7 KB Oct 2 2012 12:29 AM
Israeli PM's party plagiarizes from Texas Democrats.htm HTML File 22.8 KB Oct 2 2012 12:32 AM
IsraeliPrimeMinisterDeclaresJewWarOnIranAndSyria.html HTML File 28.1 KB Oct 2 2012 12:32 AM
Israelis Among the Holocaust Deniers.htm HTML File 2.4 KB Oct 2 2012 12:32 AM
Israeli Sexpionage - The McGreevey, Condit and Clinton Affairs.htm HTML File 12.4 KB Oct 2 2012 12:34 AM
Israelis Launch Voting Guide.htm HTML File 3.5 KB Oct 2 2012 12:31 AM
Israeli Sniper Assassinates Two Children.htm HTML File 3.1 KB Oct 2 2012 12:27 AM
Israeli Spying - The Mother of All Scandals.htm HTML File 2.8 KB Oct 2 2012 12:30 AM
Israelis Win Contract To Secure US Borders.htm HTML File 22.1 KB Oct 2 2012 12:28 AM
Israeli troops seize million dollars in bank raids across West Bank.htm HTML File 2.1 KB Oct 2 2012 12:33 AM
Israeli Website Exposes Jewish Extremism!.htm HTML File 13 KB Oct 2 2012 12:29 AM
Israel Loan Program Limited to Jews.htm HTML File 2.8 KB Oct 2 2012 12:32 AM
IsraelLobbyAndUSForeignPolicy.pdf PDF Document 1.4 MB Oct 2 2012 12:30 AM
Israel Lobby Denial.htm HTML File 14.1 KB Oct 2 2012 12:31 AM
Israel Pushing U.S. to Bomb Iran.htm HTML File 4.3 KB Oct 2 2012 12:32 AM
IsraelSexSlaveTrade.pdf PDF Document 50.9 KB Oct 2 2012 12:28 AM
IsraelSexSlaveTraffic.pdf PDF Document 956 KB Oct 2 2012 12:27 AM
israelsuspectedoftransferringuslaserweapondatatochina.html HTML File 7.9 KB Oct 2 2012 12:33 AM
israelviolatesrulesonmissilesales.html HTML File 5.4 KB Oct 2 2012 12:34 AM
Israel Wants IAEA to Ignore its Nuclear Arsenal, Concentrate on Iran.htm HTML File 3.9 KB Oct 2 2012 12:28 AM
israelweapons.pdf PDF Document 133.8 KB Oct 2 2012 12:30 AM
israelweapons.rtf RTF File 194.5 KB Oct 2 2012 12:31 AM
Israel Will Continue to Hurl Terror Bombs into Gaza Homes, Producing Wounded and Dying Children.html HTML File 44.7 KB Oct 2 2012 12:27 AM
Is There Some Bravery Left in Braveheart.htm HTML File 5.7 KB Oct 2 2012 12:31 AM
It's 1984 in Massachusetts – And Big Brother Is Gay.htm HTML File 15.5 KB Oct 2 2012 12:30 AM
It's Coming to America, Too.htm HTML File 6.2 KB Oct 2 2012 12:33 AM
It's the Genes, Stupid!.htm HTML File 21.8 KB Oct 2 2012 12:31 AM
its_a_deal.pdf PDF Document 1.1 MB Oct 2 2012 12:27 AM
I Was Israel’s Dupe.htm HTML File 5.7 KB Oct 2 2012 12:28 AM
iwc4jan.mp3 MP3 Audio 3.5 MB Oct 2 2012 12:33 AM
I Wonder What The Tiger Thinks.rtf RTF File 3.2 KB Oct 2 2012 12:31 AM
izterrorfile.pdf PDF Document 783 KB Oct 2 2012 12:34 AM
izterrorfile.rtf RTF File 515.3 KB Oct 2 2012 12:33 AM
IzzySecretServicesTruth.rtf RTF File 66.7 KB Oct 2 2012 12:32 AM
IzzySpyRing.pdf PDF Document 2 MB Oct 2 2012 12:30 AM
jackson-report.pdf PDF Document 719 KB Oct 2 2012 12:32 AM
Jagger Rejects Kabbalah after Extortion Attempt.htm HTML File 2.8 KB Oct 2 2012 12:29 AM
James and Cindy; Progress and Hope.htm HTML File 22.6 KB Oct 2 2012 12:31 AM
Jan01.pdf PDF Document 747.2 KB Oct 2 2012 12:28 AM
Jan02.pdf PDF Document 1.2 MB Oct 2 2012 12:28 AM
Jan03.pdf PDF Document 1.6 MB Oct 2 2012 12:32 AM
Jan04.pdf PDF Document 917.6 KB Oct 2 2012 12:27 AM
Janis Ian - 2002-09-16 - THE INTERNET DEBACLE – AN ALTERNATIVE VIEW.htm HTML File 32.8 KB Oct 2 2012 12:32 AM
jaws.pdf PDF Document 320.7 KB Oct 2 2012 12:33 AM
JB Cash - 2006-01-05 - Death of a Hero.htm HTML File 20.5 KB Oct 2 2012 12:29 AM
J Dub Gettin’ Funky in Durham.htm HTML File 3.5 KB Oct 2 2012 12:32 AM
Jeff A. Taylor - 2006-07-24 - Rah-Rah IDF.htm HTML File 3.4 KB Oct 2 2012 12:31 AM
Jerry Falwell Now Supports 'Gay' Rights.htm HTML File 5 KB Oct 2 2012 12:34 AM
jew-archives-previous-latest-additions.htm HTML File 5 KB Oct 2 2012 12:29 AM
jew-atrocities-blackmail_of_nations.html HTML File 2.1 KB Oct 2 2012 12:28 AM
jew-atrocities-egypt1967.html HTML File 25.3 KB Oct 2 2012 12:31 AM
jew-atrocities-folder.html HTML File 4.1 KB Oct 2 2012 12:33 AM
jew-atrocities-hebron.html HTML File 20.4 KB Oct 2 2012 12:29 AM
jew-atrocities-intifada.html HTML File 20.6 KB Oct 2 2012 12:30 AM
jew-atrocities-iraq.html HTML File 15.9 KB Oct 2 2012 12:31 AM
jew-atrocities-israelitorture.htm HTML File 31.8 KB Oct 2 2012 12:34 AM
jew-atrocities-jewsagainstjews.html HTML File 3.5 KB Oct 2 2012 12:31 AM
jew-atrocities-lebanon.html HTML File 76 KB Oct 2 2012 12:31 AM
jew-atrocities-political-correctness-crimes.html HTML File 5.4 KB Oct 2 2012 12:34 AM
jew-atrocities-slaves-jewish-slave-ship-owners.html HTML File 5.8 KB Oct 2 2012 12:28 AM
jew-atrocities-slaves.html HTML File 7.1 KB Oct 2 2012 12:34 AM
jew-communists-HUAC-Lists.htm HTML File 80.4 KB Oct 2 2012 12:27 AM
jew-communists-joe-mccarthy-and-the-jews.html HTML File 42.9 KB Oct 2 2012 12:33 AM
jew-communists-rothschild-banks.html HTML File 53.4 KB Oct 2 2012 12:31 AM
jew-communists.html HTML File 30.4 KB Oct 2 2012 12:31 AM
jew-crime-mob-russia-ussr.html HTML File 101.6 KB Oct 2 2012 12:33 AM
jew-criminalsandspies-bentley.html HTML File 4.1 KB Oct 2 2012 12:31 AM
jew-criminalsandspies-elitcher-max.html HTML File 4.1 KB Oct 2 2012 12:30 AM
jew-criminalsandspies-feklisov.html HTML File 4.9 KB Oct 2 2012 12:31 AM
jew-criminalsandspies-folder.html HTML File 4.4 KB Oct 2 2012 12:30 AM
jew-criminalsandspies-fuchs.html HTML File 6.4 KB Oct 2 2012 12:33 AM
jew-criminalsandspies-gold.html HTML File 4.2 KB Oct 2 2012 12:30 AM
jew-criminalsandspies-greenglass-wife.html HTML File 4 KB Oct 2 2012 12:34 AM
jew-criminalsandspies-greenglass.html HTML File 5.3 KB Oct 2 2012 12:27 AM
jew-criminalsandspies-hall.html HTML File 23.4 KB Oct 2 2012 12:31 AM
jew-criminalsandspies-oppenheimer-robert.html HTML File 10.7 KB Oct 2 2012 12:30 AM
jew-criminalsandspies-perl.html HTML File 5.5 KB Oct 2 2012 12:33 AM
jew-criminalsandspies-pollard.html HTML File 2.9 KB Oct 2 2012 12:30 AM
jew-criminalsandspies-rosenberg.html HTML File 3.8 KB Oct 2 2012 12:32 AM
jew-criminalsandspies-sobell.html HTML File 27.4 KB Oct 2 2012 12:29 AM
jew-criminalsandspies-vanunu.html HTML File 19.1 KB Oct 2 2012 12:28 AM
jew-genocide-black-holocaust-abolition-myth.html HTML File 19.8 KB Oct 2 2012 12:27 AM
jew-genocide-gentilehate.html HTML File 19 KB Oct 2 2012 12:30 AM
jew-genocide-palestinian-qana.htm HTML File 18 KB Oct 2 2012 12:32 AM
jew-genocide-USSRchristians-antisemitismcrime.html HTML File 6 KB Oct 2 2012 12:28 AM
jew-genocide-USSRchristians-JAC.html HTML File 3.9 KB Oct 2 2012 12:30 AM
jew-jewishbankingandfinancialmanipulations-folder.html HTML File 26.4 KB Oct 2 2012 12:33 AM
jew-jewishbankingandfinancialmanipulations-food-companies.html HTML File 9.6 KB Oct 2 2012 12:29 AM
jew-jewishbankingandfinancialmanipulations-islam-off-dow-jones.html HTML File 19.7 KB Oct 2 2012 12:28 AM
jew-jewishbankingandfinancialmanipulations-mcfadden-speech.html HTML File 104.4 KB Oct 2 2012 12:31 AM
jew-jewishbankingandfinancialmanipulations-secretsofthefederalreservebyeustace mullins.html HTML File 602.7 KB Oct 2 2012 12:32 AM
jew-jewishsupremacyassociationsmovements-art-organizations.html HTML File 7.2 KB Oct 2 2012 12:32 AM
jew-jewishsupremacyassociationsmovements-associations.html HTML File 108.2 KB Oct 2 2012 12:28 AM
jew-jewishsupremacyassociationsmovements-cultural-ethnic-associations.html HTML File 14.6 KB Oct 2 2012 12:33 AM
jew-jewishsupremacyassociationsmovements-environment-movements.html HTML File 7 KB Oct 2 2012 12:28 AM
jew-jewishsupremacyassociationsmovements-family-women-sex-gender-issues.html HTML File 13.4 KB Oct 2 2012 12:33 AM
jew-jewishsupremacyassociationsmovements-folder.html HTML File 5.1 KB Oct 2 2012 12:33 AM
jew-jewishsupremacyassociationsmovements-foundations-grants-orgs.html HTML File 7.7 KB Oct 2 2012 12:30 AM
jew-jewishsupremacyassociationsmovements-hate-genocide.html HTML File 7.5 KB Oct 2 2012 12:31 AM
jew-jewishsupremacyassociationsmovements-immigration.html HTML File 6.5 KB Oct 2 2012 12:30 AM
jew-jewishsupremacyassociationsmovements-law-rights.html HTML File 11.8 KB Oct 2 2012 12:31 AM
jew-jewishsupremacyassociationsmovements-mass-media-associations.html HTML File 17.1 KB Oct 2 2012 12:28 AM
jew-jewishsupremacyassociationsmovements-money-business-organizations.html HTML File 15 KB Oct 2 2012 12:27 AM
jew-jewishsupremacyassociationsmovements-politics.html HTML File 22.4 KB Oct 2 2012 12:27 AM
jew-jewishsupremacyassociationsmovements-religious.html HTML File 10.9 KB Oct 2 2012 12:28 AM
jew-jewishsupremacyassociationsmovements-think-tanks-others.html HTML File 12.6 KB Oct 2 2012 12:31 AM
jew-jewishsupremacyassociationsmovements-unions-occupations-others.html HTML File 16.4 KB Oct 2 2012 12:29 AM
jew-jewishsupremacyassociationsmovements-universities.html HTML File 18.4 KB Oct 2 2012 12:31 AM
jew-leaders-attorneys.html HTML File 3 KB Oct 2 2012 12:29 AM
jew-leaders-begin.html HTML File 9 KB Oct 2 2012 12:33 AM
jew-leaders-ben-gurion.html HTML File 87.2 KB Oct 2 2012 12:30 AM
jew-leaders-churchill.html HTML File 6 KB Oct 2 2012 12:33 AM
jew-leaders-dayan.html HTML File 4.6 KB Oct 2 2012 12:27 AM
jew-leaders-eisenhower.html HTML File 7.4 KB Oct 2 2012 12:31 AM
jew-leaders-executives.html HTML File 3.7 KB Oct 2 2012 12:28 AM
jew-leaders-famousjewslist.html HTML File 15.6 KB Oct 2 2012 12:30 AM
jew-leaders-folder.html HTML File 9.3 KB Oct 2 2012 12:34 AM
jew-leaders-frank.html HTML File 2.2 KB Oct 2 2012 12:29 AM
jew-leaders-hertzl.html HTML File 2.7 KB Oct 2 2012 12:28 AM
jew-leaders-kaganovich.html HTML File 45 KB Oct 2 2012 12:31 AM
jew-leaders-kahane.html HTML File 3.4 KB Oct 2 2012 12:34 AM
jew-leaders-luxemberg.html HTML File 24 KB Oct 2 2012 12:27 AM
jew-leaders-mafia.html HTML File 4.5 KB Oct 2 2012 12:30 AM
jew-leaders-netanyahu.html HTML File 3.1 KB Oct 2 2012 12:34 AM
jew-leaders-rabin.html HTML File 1.9 KB Oct 2 2012 12:31 AM
jew-leaders-roosevelt.html HTML File 5.7 KB Oct 2 2012 12:31 AM
jew-leaders-rothschild.html HTML File 5.1 KB Oct 2 2012 12:31 AM
jew-leaders-stalin.html HTML File 7.3 KB Oct 2 2012 12:32 AM
jew-leaders-trotsky.htm HTML File 6.5 KB Oct 2 2012 12:30 AM
jew-leaders-ussr-pm-yevgeny-primakov.html HTML File 3.6 KB Oct 2 2012 12:31 AM
jew-leaders-yagoda.html HTML File 5 KB Oct 2 2012 12:32 AM
jew-mafia.htm HTML File 26 KB Oct 2 2012 12:33 AM
jew-mindcontrol-anarchism.html HTML File 12.1 KB Oct 2 2012 12:29 AM
jew-mindcontrol-atheism.html HTML File 87.9 KB Oct 2 2012 12:30 AM
jew-mindcontrol-civil-rights.html HTML File 9.4 KB Oct 2 2012 12:30 AM
jew-mindcontrol-communism.html HTML File 8.3 KB Oct 2 2012 12:27 AM
jew-mindcontrol-feminism.html HTML File 25.4 KB Oct 2 2012 12:30 AM
jew-mindcontrol-folder.html HTML File 3.8 KB Oct 2 2012 12:29 AM
jew-mindcontrol-freudianism.html HTML File 59.7 KB Oct 2 2012 12:33 AM
jew-mindcontrol-homosexuality.html HTML File 13.5 KB Oct 2 2012 12:28 AM
jew-mindcontrol-immigration.html HTML File 3.8 KB Oct 2 2012 12:33 AM
jew-mindcontrol-liberalism.html HTML File 5 KB Oct 2 2012 12:34 AM
jew-mindcontrol-new-left.html HTML File 319.3 KB Oct 2 2012 12:28 AM
jew-occupiedgovernments-australia.html HTML File 2.1 KB Oct 2 2012 12:29 AM
jew-occupiedgovernments-austria.html HTML File 3.7 KB Oct 2 2012 12:30 AM
jew-occupiedgovernments-CIS.html HTML File 2.5 KB Oct 2 2012 12:30 AM
jew-occupiedgovernments-folder.html HTML File 2.4 KB Oct 2 2012 12:32 AM
jew-occupiedgovernments-france.html HTML File 5.5 KB Oct 2 2012 12:31 AM
jew-occupiedgovernments-germany-hitlers-jew-support.html HTML File 13.2 KB Oct 2 2012 12:33 AM
jew-occupiedgovernments-germany.html HTML File 27.6 KB Oct 2 2012 12:32 AM
jew-occupiedgovernments-israel-iq.html HTML File 148.9 KB Oct 2 2012 12:33 AM
jew-occupiedgovernments-israel.html HTML File 46.7 KB Oct 2 2012 12:27 AM
jew-occupiedgovernments-poland.html HTML File 7.1 KB Oct 2 2012 12:28 AM
jew-occupiedgovernments-uk.html HTML File 11.7 KB Oct 2 2012 12:34 AM
jew-occupiedgovernments-usa-sds.html HTML File 17.1 KB Oct 2 2012 12:31 AM
jew-occupiedgovernments-usa.html HTML File 44.6 KB Oct 2 2012 12:30 AM
jew-occupiedgovernments-USSR-historians.html HTML File 19.6 KB Oct 2 2012 12:32 AM
jew-occupiedgovernments-USSR-jewish-bolsheviks-answer.com.html HTML File 34 KB Oct 2 2012 12:33 AM
jew-occupiedgovernments-USSR-Jewish-Bolshevism-Bolsheviks.html HTML File 58.4 KB Oct 2 2012 12:29 AM
jew-occupiedgovernments-USSR-moreevidence - Historical Sources.htm HTML File 36.4 KB Oct 2 2012 12:31 AM
jew-occupiedgovernments-USSR-moreevidence.html HTML File 35.7 KB Oct 2 2012 12:33 AM
jew-occupiedgovernments-USSR-revolution.html HTML File 8.9 KB Oct 2 2012 12:28 AM
jew-occupiedgovernments-USSR-victim-email.html HTML File 5.4 KB Oct 2 2012 12:33 AM
jew-occupiedgovernments-USSR.html HTML File 122.5 KB Oct 2 2012 12:34 AM
jew-occupiedgovernments-vatican.html HTML File 25.7 KB Oct 2 2012 12:32 AM
jew-organizations-ACLU.html HTML File 2.9 KB Oct 2 2012 12:32 AM
jew-organizations-ADL.html HTML File 190.4 KB Oct 2 2012 12:33 AM
jew-organizations-AIPAC.html HTML File 8.1 KB Oct 2 2012 12:33 AM
jew-organizations-bnaibrith.html HTML File 30 KB Oct 2 2012 12:28 AM
jew-organizations-folder.html HTML File 3.8 KB Oct 2 2012 12:28 AM
jew-organizations-JDL-Zionist-Terror-Network-IHR.htm HTML File 107.4 KB Oct 2 2012 12:27 AM
jew-organizations-JDL.html HTML File 3.1 KB Oct 2 2012 12:28 AM
jew-organizations-jewishbund.html HTML File 4.3 KB Oct 2 2012 12:29 AM
jew-organizations-NAACP.html HTML File 5.2 KB Oct 2 2012 12:29 AM
jew-organizations-NOW.html HTML File 3.8 KB Oct 2 2012 12:32 AM
jew-organizations-penetration-white-european-orgs.html HTML File 14.3 KB Oct 2 2012 12:28 AM
jew-organizations-splc.html HTML File 12.7 KB Oct 2 2012 12:27 AM
jew-organizations-wiesenthal.html HTML File 147 KB Oct 2 2012 12:31 AM
jew-organizations-WZO.html HTML File 10.4 KB Oct 2 2012 12:31 AM
jew-radio-folder.html HTML File 11.7 KB Oct 2 2012 12:32 AM
jew-references-blogs.html HTML File 13.8 KB Oct 2 2012 12:34 AM
jew-references-daskapital.html HTML File 3.7 KB Oct 2 2012 12:31 AM
jew-references-gentile-whatotherssay - What world famous men said about the Jews.htm HTML File 86.4 KB Oct 2 2012 12:33 AM
jew-religions-judaism.html HTML File 2.9 KB Oct 2 2012 12:31 AM
jew-religions-millenium.html HTML File 6.3 KB Oct 2 2012 12:33 AM
jew-terrorists-aipac-pentagon.html HTML File 3.5 KB Oct 2 2012 12:27 AM
jew-terrorists-folder.html HTML File 5.1 KB Oct 2 2012 12:31 AM
jew-terrorists-jewish-zionist-terrorists.html HTML File 14.8 KB Oct 2 2012 12:32 AM
jew-terrorists-mossad.html HTML File 80.4 KB Oct 2 2012 12:30 AM
jew-terrorists-shin_bet.html HTML File 14.6 KB Oct 2 2012 12:31 AM
jew-usenet.html HTML File 2.1 KB Oct 2 2012 12:28 AM
jew1.jpg JPEG Image 46.2 KB Oct 2 2012 12:33 AM
jew2.jpg JPEG Image 52.8 KB Oct 2 2012 12:34 AM
jewbrain.jpg JPEG Image 33.1 KB Oct 2 2012 12:29 AM
JewDefectorWarnAmerica.pdf PDF Document 31.8 KB Oct 2 2012 12:32 AM
JewExpulsions.pdf PDF Document 16.9 KB Oct 2 2012 12:28 AM
jewface.exe DOS/WIN Executable 10.5 MB Oct 2 2012 12:27 AM
JewImmigrationPolicy.pdf PDF Document 163.5 KB Oct 2 2012 12:34 AM
Jewish 'Muslim' Threatens West with Genocide.htm HTML File 4.1 KB Oct 2 2012 12:27 AM
Jewish Academic Blasts Middle-class Whites for Not 'Integrating' Kids.htm HTML File 5.1 KB Oct 2 2012 12:31 AM
Jewish Anti-Gentile Hatred in Porn Industry.htm HTML File 4.6 KB Oct 2 2012 12:29 AM
Jewish Censors Seek to Ban Dissident White Historian.htm HTML File 2.4 KB Oct 2 2012 12:33 AM
JEWISH CRIME.htm HTML File 125.8 KB Oct 2 2012 12:27 AM
Jewish Genetic Diseases.htm HTML File 39.5 KB Oct 2 2012 12:32 AM
Jewish Genetic Diseases 2.htm HTML File 25.8 KB Oct 2 2012 12:31 AM
Jewish Hate, the Media, and the ADL.htm HTML File 23.1 KB Oct 2 2012 12:31 AM
JewishHistoryJewishReligion.pdf PDF Document 420.7 KB Oct 2 2012 12:28 AM
jewish involvement in immigration.pdf PDF Document 191.7 KB Oct 2 2012 12:31 AM
Jewish Lawyer Edward Fagan to Sue African Marxists.htm HTML File 4.3 KB Oct 2 2012 12:29 AM
Jewish Leader Calls On Zionists To Kill All Palestinian Males.htm HTML File 25.4 KB Oct 2 2012 12:31 AM
Jewish Mafia Expands White Slave Trade to London.htm HTML File 2.4 KB Oct 2 2012 12:30 AM
Jewish Porn King May Have Skipped to Israel.htm HTML File 3.4 KB Oct 2 2012 12:31 AM
Jewish rabbi calls for extermination of all Palestinian males.htm HTML File 7.2 KB Oct 2 2012 12:33 AM
JewishRitualMurder.pdf PDF Document 301.7 KB Oct 2 2012 12:31 AM
jewish stake in immigration.pdf PDF Document 93.5 KB Oct 2 2012 12:30 AM
Jewish Support for Open Borders - Is it Biological.htm HTML File 8.8 KB Oct 2 2012 12:27 AM
jewishsupremacism.pdf PDF Document 3.3 MB Oct 2 2012 12:31 AM
jewish supremacism preface.pdf PDF Document 85 KB Oct 2 2012 12:33 AM
Jewish Supremacist Michael Chertoff Named Head of Homeland Security.htm HTML File 10.4 KB Oct 2 2012 12:31 AM
Jewish Supremacists Shaping Election of UN Secretary General.htm HTML File 9 KB Oct 2 2012 12:32 AM
JewishTalmudOrg.PDF PDF Document 1.1 MB Oct 2 2012 12:33 AM
Jewish Terrorist Gets Prison.htm HTML File 3.3 KB Oct 2 2012 12:30 AM
Jewish Usury and Finance Capital.htm HTML File 39.8 KB Oct 2 2012 12:27 AM
Jewish Voters Object to New Polling Place.htm HTML File 2.8 KB Oct 2 2012 12:33 AM
Jewish Voters Object to New Polling Place2.htm HTML File 7.3 KB Oct 2 2012 12:33 AM
JewishWarOfSurvival.pdf PDF Document 182.4 KB Oct 2 2012 12:31 AM
Jewish WMD Whistleblower Vanunu Released But Not Free.htm HTML File 10.2 KB Oct 2 2012 12:31 AM
JewishWorldConquest.rtf RTF File 125.9 KB Oct 2 2012 12:28 AM
jewish_media_control.pdf PDF Document 627.4 KB Oct 2 2012 12:33 AM
jewish_supremacism.pdf PDF Document 3.3 MB Oct 2 2012 12:32 AM
jewquestion.pdf PDF Document 706.1 KB Oct 2 2012 12:34 AM
jewquestion.rtf RTF File 381.2 KB Oct 2 2012 12:33 AM
JewReligionInfluenceToday.pdf PDF Document 1.5 MB Oct 2 2012 12:33 AM
JewRoleInBolshevikRevolution.pdf PDF Document 119.3 KB Oct 2 2012 12:32 AM
Jews - A Religious Community, a People, or a Race.htm HTML File 5.9 KB Oct 2 2012 12:33 AM
jews.html HTML File 40 KB Oct 2 2012 12:32 AM
jews.jpg JPEG Image 21.5 KB Oct 2 2012 12:27 AM
Jews Admit - Iran Is Israel’s “Greatest Threat”.htm HTML File 4.1 KB Oct 2 2012 12:31 AM
JewsAndTheirLies.pdf PDF Document 265.4 KB Oct 2 2012 12:31 AM
Jews And Their Zionist Views.htm HTML File 13.6 KB Oct 2 2012 12:30 AM
JewsAtSteeringWheel.pdf PDF Document 108.8 KB Oct 2 2012 12:28 AM
jews beat Santa Clause.htm HTML File 30.2 KB Oct 2 2012 12:33 AM
jewsgermany.jpg JPEG Image 261.5 KB Oct 2 2012 12:34 AM
JewsIQ.pdf PDF Document 1.7 MB Oct 2 2012 12:31 AM
Jews Push Homosexual 'Reality' TV Shows.htm HTML File 3.6 KB Oct 2 2012 12:30 AM
Jews Relentless In Pursuit of Internet Censorship.htm HTML File 13.2 KB Oct 2 2012 12:34 AM
Jew Threatens LA With New 9-11.htm HTML File 7 KB Oct 2 2012 12:32 AM
Jingle Jam Chaos Closes Minnesota Mall.htm HTML File 3.6 KB Oct 2 2012 12:28 AM
John Barleycorn.htm HTML File 3.8 KB Oct 2 2012 12:30 AM
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency.htm HTML File 26.1 KB Oct 2 2012 12:33 AM
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency.txt Text File 18 KB Oct 2 2012 12:28 AM
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution, continued.htm HTML File 60.6 KB Oct 2 2012 12:27 AM
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution.htm HTML File 75.2 KB Oct 2 2012 12:33 AM
John H. Campbell - The Moral Imperative of Our Future Evolution.htm HTML File 108.1 KB Oct 2 2012 12:31 AM
JohnJayJewel.pdf PDF Document 102 KB Oct 2 2012 12:32 AM
John Moffat - 2005-08-15 - How Whites Won and Lost a Continent.txt Text File 14.9 KB Oct 2 2012 12:30 AM
John Tyndall - An Anagogical View of Empire.htm HTML File 8.5 KB Oct 2 2012 12:28 AM
Journalist Held In Dungeon Of Filth.htm HTML File 1.9 KB Oct 2 2012 12:28 AM
joys.pdf PDF Document 287.1 KB Oct 2 2012 12:32 AM
JudaismInMusic.pdf PDF Document 72.5 KB Oct 2 2012 12:31 AM
judeadeclareswar.pdf PDF Document 84.4 KB Oct 2 2012 12:31 AM
Judea declares war on Germany.htm HTML File 28.6 KB Oct 2 2012 12:31 AM
Judeo-Fascism.htm HTML File 3.7 KB Oct 2 2012 12:27 AM
Jul02.pdf PDF Document 1.7 MB Oct 2 2012 12:34 AM
Jul03.pdf PDF Document 779.3 KB Oct 2 2012 12:34 AM
Jul04.pdf PDF Document 749.2 KB Oct 2 2012 12:33 AM
July01.pdf PDF Document 773.2 KB Oct 2 2012 12:28 AM
Jun01.pdf PDF Document 1.2 MB Oct 2 2012 12:33 AM
Jun02.pdf PDF Document 1.4 MB Oct 2 2012 12:29 AM
Jun03.pdf PDF Document 684.4 KB Oct 2 2012 12:31 AM
Jun04.pdf PDF Document 1 MB Oct 2 2012 12:31 AM
Jury Selection to Be Moved in Bloodbath Trial.htm HTML File 2.7 KB Oct 2 2012 12:33 AM
JustificationOfTerror.pdf PDF Document 13.1 KB Oct 2 2012 12:34 AM
just_say_yes.pdf PDF Document 753.4 KB Oct 2 2012 12:32 AM
Kaballah Crazy!.htm HTML File 3.6 KB Oct 2 2012 12:30 AM
Kabbalah Red String Market Threatened.htm HTML File 3.4 KB Oct 2 2012 12:31 AM
Kalevala.pdf PDF Document 1 MB Oct 2 2012 12:31 AM
Kathleen Christiso - 2006-09-12 - The Coming Collapse of Zionism.htm HTML File 33 KB Oct 2 2012 12:30 AM
Katrina, Iraq, and the Know-It-All Syndrome.htm HTML File 3.7 KB Oct 2 2012 12:34 AM
Katrina - Neo-con Pals Rake in the Dough.htm HTML File 3.5 KB Oct 2 2012 12:32 AM
Katrina and the Black Tsunami.htm HTML File 29.1 KB Oct 2 2012 12:30 AM
Katrina Black Tells Fox You Owe Him.htm HTML File 5.2 KB Oct 2 2012 12:28 AM
Katrina Evacuee Charged with Child Murder.htm HTML File 3.5 KB Oct 2 2012 12:31 AM
Katrina Evacuees Binge on Cape Cod.htm HTML File 4.1 KB Oct 2 2012 12:28 AM
Katrina Students Spark Constitutional Debate.htm HTML File 3.4 KB Oct 2 2012 12:29 AM
Katrina Tensions - School Official Resigns over Remarks.htm HTML File 3.4 KB Oct 2 2012 12:27 AM
Katrina Threatens Croatian-American Tradition.htm HTML File 4.4 KB Oct 2 2012 12:31 AM
Katrina Threatens to Swamp Utah.htm HTML File 5.6 KB Oct 2 2012 12:28 AM
Katrina Unleashes HIV+ Horde.htm HTML File 3.7 KB Oct 2 2012 12:27 AM
Katrina Victims Unwelcome in Some Towns.htm HTML File 3.8 KB Oct 2 2012 12:33 AM
kdrebel.pdf PDF Document 424.8 KB Oct 2 2012 12:31 AM
kdrebel.rtf RTF File 317.7 KB Oct 2 2012 12:28 AM
Keitel.pdf PDF Document 1.2 MB Oct 2 2012 12:32 AM
Kenya - Black Priest Kills White Roman Catholic Bishop.htm HTML File 2.9 KB Oct 2 2012 12:31 AM
Kill a Cracker Day.htm HTML File 2.2 KB Oct 2 2012 12:30 AM
Kill Arabs, Cry Anti-Semitism.htm HTML File 4.5 KB Oct 2 2012 12:34 AM
Killer Plays Race Card.htm HTML File 6.9 KB Oct 2 2012 12:27 AM
Kill the Christians.htm HTML File 3.3 KB Oct 2 2012 12:28 AM
Kirkby TV Covers Reconquista.htm HTML File 3.3 KB Oct 2 2012 12:33 AM
KKKChristmasCardDOUBLEfold.pdf PDF Document 292.3 KB Oct 2 2012 12:31 AM
KKKChristmasCardSINGLEfold.pdf PDF Document 315.9 KB Oct 2 2012 12:34 AM
Klassen.pdf PDF Document 390.5 KB Oct 2 2012 12:30 AM
KlassenCD-Insert.pdf PDF Document 86.5 KB Oct 2 2012 12:33 AM
KlassenCD-ReOrderForm.pdf PDF Document 69.4 KB Oct 2 2012 12:30 AM
KlassenCD-TrayLiner.pdf PDF Document 578.4 KB Oct 2 2012 12:30 AM
know_your_rights.pdf PDF Document 7.6 KB Oct 2 2012 12:28 AM
Kook Conspiracy Theories - Reject Them.htm HTML File 11.4 KB Oct 2 2012 12:33 AM
KosherFoodTax.pdf PDF Document 3.5 MB Oct 2 2012 12:28 AM
Kosovo - A Dangerous Cosmetic Salon.htm HTML File 2.4 KB Oct 2 2012 12:29 AM
kp-3.pdf PDF Document 2.2 MB Oct 2 2012 12:33 AM
KULA.pdf PDF Document 5.8 MB Oct 2 2012 12:27 AM
Kurdish soldiers trained by Israelis.htm HTML File 4.5 KB Oct 2 2012 12:28 AM
Lamb Gaede - 11-year-old White Girl Stands for Truth in California.htm HTML File 5.8 KB Oct 2 2012 12:31 AM
Lambing Flat.htm HTML File 8.9 KB Oct 2 2012 12:33 AM
Land Of Dope And Jewry.htm HTML File 22.5 KB Oct 2 2012 12:33 AM
La Pauvre Petite - Schoolgirl abduction-murder rivets France.htm HTML File 4.8 KB Oct 2 2012 12:31 AM
Lapdance King, Lawyer Indicted in 'Mafia' Probe.htm HTML File 5.1 KB Oct 2 2012 12:34 AM
La Raza List of Corporate Traitors.htm HTML File 9.1 KB Oct 2 2012 12:28 AM
LatviaYearOfHorror.pdf PDF Document 6.6 MB Oct 2 2012 12:31 AM
Law Enforcement Embattled in New Orleans.htm HTML File 2.9 KB Oct 2 2012 12:31 AM
leaderlessresistance.htm HTML File 22.1 KB Oct 2 2012 12:28 AM
LeaderlessResistance.pdf PDF Document 53.4 KB Oct 2 2012 12:31 AM
LearningAboutHomos.pdf PDF Document 1.2 MB Oct 2 2012 12:31 AM
Leftist Violence Flares at Norwegian Election Event.htm HTML File 2.6 KB Oct 2 2012 12:33 AM
leif_eriksson.pdf PDF Document 395.2 KB Oct 2 2012 12:32 AM
lemmingsrefusetoacceptfactsofracialdifferencesinintelligence.html HTML File 4.3 KB Oct 2 2012 12:31 AM
Letter - A Father Pleads for His Son's Future.htm HTML File 4.6 KB Oct 2 2012 12:34 AM
Letter from Atlanta - The Seamy Gold Club Trial.htm HTML File 20.4 KB Oct 2 2012 12:29 AM
LeuchterReport.pdf PDF Document 2.2 MB Oct 2 2012 12:30 AM
Levithian.pdf PDF Document 1 MB Oct 2 2012 12:29 AM
LFS-BOOK-6.2.pdf PDF Document 797.5 KB Oct 2 2012 12:31 AM
LFS - essential_prereading Unknown 12.7 KB Oct 2 2012 12:30 AM
LiarWeasel.pdf PDF Document 62.8 KB Oct 2 2012 12:33 AM
Libby - press_advisory_1028.pdf PDF Document 34.3 KB Oct 2 2012 12:28 AM
libby_indictment_28102005.pdf PDF Document 152.6 KB Oct 2 2012 12:33 AM
Liberating America From Israel.htm HTML File 9.6 KB Oct 2 2012 12:33 AM
LifeIn3rdReich.pdf PDF Document 55.6 KB Oct 2 2012 12:28 AM
LifeInHitlersGermany.pdf PDF Document 446 KB Oct 2 2012 12:28 AM
Light for Nations - A Short History of the Jews in the Modern World.txt Text File 60 KB Oct 2 2012 12:32 AM
lightningsun.pdf PDF Document 1.4 MB Oct 2 2012 12:33 AM
lightningsun.rtf RTF File 5.3 MB Oct 2 2012 12:28 AM
links.html HTML File 34.6 KB Oct 2 2012 12:28 AM
Links Of White Interest.txt Text File 4.9 KB Oct 2 2012 12:31 AM
Linux+IPv6-HOWTO.pdf PDF Document 769.1 KB Oct 2 2012 12:30 AM
lipshit.pdf PDF Document 1.5 MB Oct 2 2012 12:30 AM
Lisa Rad - 2006-02-15 - Fall of the Fourth Reich.htm HTML File 50.7 KB Oct 2 2012 12:31 AM
list-of-jews.htm HTML File 464.7 KB Oct 2 2012 12:30 AM
littlemary-mp3.ram RAM File 67 Bytes Oct 2 2012 12:32 AM
littlemary.mp3 MP3 Audio 3.3 MB Oct 2 2012 12:32 AM
London - Jewish Mafia Loses Three Soldiers.htm HTML File 6.5 KB Oct 2 2012 12:27 AM
London Mayor Challenges Suspension.htm HTML File 2.7 KB Oct 2 2012 12:28 AM
Looking to Belong.htm HTML File 6.5 KB Oct 2 2012 12:30 AM
LordOfTheRings.pdf PDF Document 13 MB Oct 2 2012 12:30 AM
lost_boy.pdf PDF Document 291 KB Oct 2 2012 12:33 AM
lost_boy_2.pdf PDF Document 328.3 KB Oct 2 2012 12:30 AM
lotrlit.zip ZIP Archive 1.5 MB Oct 2 2012 12:31 AM
Louis Beam - Leaderless Resistance - 1983.pdf PDF Document 53.4 KB Oct 2 2012 12:31 AM
Louisiana - Town's First Black Police Chief Charged in Crack Probe.htm HTML File 4.5 KB Oct 2 2012 12:34 AM
Louisiana National Guard Troops Watch Katrina from Iraq.htm HTML File 3.1 KB Oct 2 2012 12:33 AM
Louisiana Senator Threatens To Assault Bush.htm HTML File 4.4 KB Oct 2 2012 12:30 AM
love-your-race.pdf PDF Document 281 KB Oct 2 2012 12:29 AM
Low-paid illegal work force has little impact on prices - 2.htm HTML File 33.1 KB Oct 2 2012 12:33 AM
Low-paid illegal work force has little impact on prices.htm HTML File 12.3 KB Oct 2 2012 12:31 AM
lwb.pdf PDF Document 205.2 KB Oct 2 2012 12:27 AM
M. P. Shiel - 2006-03-07 - Equality, Democracy, and their Killing Fields.htm HTML File 17.2 KB Oct 2 2012 12:31 AM
MacQueen.pdf PDF Document 692.4 KB Oct 2 2012 12:31 AM
MacWorld US - 2007 04.pdf PDF Document 23.5 MB Oct 2 2012 12:33 AM
Madame_Guillotine.pdf PDF Document 114.8 KB Oct 2 2012 12:31 AM
Madonna Listed Among America's 'Most Powerful Jews'.htm HTML File 4.9 KB Oct 2 2012 12:30 AM
MagnaCarta.pdf PDF Document 29.8 KB Oct 2 2012 12:27 AM
main.css Stylesheet 1022 Bytes Oct 2 2012 12:32 AM
maine.pdf PDF Document 571.1 KB Oct 2 2012 12:27 AM
maine_rape.pdf PDF Document 718.9 KB Oct 2 2012 12:32 AM
Make Your Cheque out to God-Cash.htm HTML File 3.4 KB Oct 2 2012 12:29 AM
Mali - Africans Still Practice Human Sacrifice.htm HTML File 8.3 KB Oct 2 2012 12:34 AM
MalleusAcrobat.pdf PDF Document 2.4 MB Oct 2 2012 12:31 AM
malleus_maleficarum.zip ZIP Archive 795.3 KB Oct 2 2012 12:28 AM
ManagementSummary-V2.2.pdf PDF Document 1.1 MB Oct 2 2012 12:33 AM
manifeste.pdf PDF Document 567.8 KB Oct 2 2012 12:30 AM
Mar01.pdf PDF Document 895.5 KB Oct 2 2012 12:31 AM
Mar02.pdf PDF Document 1.4 MB Oct 2 2012 12:31 AM
Mar03.pdf PDF Document 1 MB Oct 2 2012 12:31 AM
Mar04.pdf PDF Document 1.2 MB Oct 2 2012 12:31 AM
Mar06.pdf PDF Document 807 KB Oct 2 2012 12:32 AM
marchupcountry.pdf PDF Document 891.6 KB Oct 2 2012 12:31 AM
marchupcountry.rtf RTF File 2.3 MB Oct 2 2012 12:29 AM
Marcus Epstein and Michelle Malkin.htm HTML File 24.7 KB Oct 2 2012 12:33 AM
MaresNest.pdf PDF Document 1.1 MB Oct 2 2012 12:32 AM
Marian Evans -- Catastrophe in Kansas City.htm HTML File 81.4 KB Oct 2 2012 12:31 AM
Mariel Deja Vu.htm HTML File 4.1 KB Oct 2 2012 12:33 AM
Mark Weber - 2004-07-09 - ADL Strongman Panics at Break in 'Holocaust' Party Line.txt Text File 18.8 KB Oct 2 2012 12:28 AM
Mark Weber - 2006-02-10 - Holocaust Survivor Memoir Exposed as Fraud.htm HTML File 7.6 KB Oct 2 2012 12:32 AM
Mark Weber - 2006-03-16 - The Jewish Role in the Bolshevik Revolution and Russia's Early Soviet Regime.htm HTML File 18.3 KB Oct 2 2012 12:32 AM
Marshall - The Last Circle (unpublished manuscript on the Octopus mafia organization) (1994).pdf PDF Document 471.7 KB Oct 2 2012 12:32 AM
Marshals - Innocent People Placed On 'Watch List' To Meet Quota.htm HTML File 3.5 KB Oct 2 2012 12:33 AM
Marxists Gamble on Geeks.htm HTML File 11.6 KB Oct 2 2012 12:28 AM
MaryPhaghanSong.htm HTML File 9.5 KB Oct 2 2012 12:33 AM
Mass Grave Containing Kosovo Serbs Found.htm HTML File 2.9 KB Oct 2 2012 12:28 AM
Mass Grave of Massacred Poles Found in Ukraine.htm HTML File 25.9 KB Oct 2 2012 12:29 AM
Massive Debt Could Trigger Great Depression.htm HTML File 4.5 KB Oct 2 2012 12:32 AM
Matthew Downing - 2006-03-24 - Massachusetts - Pro-White Outreach Frustrates Local Media, ADL.htm HTML File 15.7 KB Oct 2 2012 12:33 AM
Matthew Hale - Justice Denied.htm HTML File 12.6 KB Oct 2 2012 12:31 AM
May01.pdf PDF Document 791.5 KB Oct 2 2012 12:30 AM
May02.pdf PDF Document 1.5 MB Oct 2 2012 12:27 AM
May03.pdf PDF Document 1 MB Oct 2 2012 12:29 AM
May04.pdf PDF Document 1.2 MB Oct 2 2012 12:33 AM
MBOE.pdf PDF Document 5.7 MB Oct 2 2012 12:30 AM
mcveigh.htm HTML File 24 KB Oct 2 2012 12:30 AM
mcveigh.pdf PDF Document 136.3 KB Oct 2 2012 12:33 AM
mediabypass.pdf PDF Document 745.4 KB Oct 2 2012 12:29 AM
Media Note - 'Michael Savage' Lashes Out Against Nick Berg and His Family.htm HTML File 2.5 KB Oct 2 2012 12:31 AM
Medicating heretics.htm HTML File 9.1 KB Oct 2 2012 12:33 AM
meet_your_neighbors.pdf PDF Document 1.6 MB Oct 2 2012 12:32 AM
MeinKampf.pdf PDF Document 1.2 MB Oct 2 2012 12:33 AM
meinkampf.rtf RTF File 3.5 MB Oct 2 2012 12:31 AM
meinkampf.zip ZIP Archive 702.5 KB Oct 2 2012 12:31 AM
Melchizedek_Drunvalo_#BF2F1.pdf PDF Document 3.9 MB Oct 2 2012 12:28 AM
Mel Gibson's Anti-Zionist Priest Dies.htm HTML File 8 KB Oct 2 2012 12:31 AM
Mel Gibson Denounces Jews' War.htm HTML File 24 KB Oct 2 2012 12:33 AM
memberapp.html HTML File 2.8 KB Oct 2 2012 12:28 AM
Memo Proves Brown Paid for Chertoff's Incompetence.htm HTML File 3.6 KB Oct 2 2012 12:33 AM
memories%20of%20freedom.pdf PDF Document 4.5 MB Oct 2 2012 12:30 AM
menu.htm HTML File 18 KB Oct 2 2012 12:30 AM
Merry Christmas -- and on to Victory!.htm HTML File 10.7 KB Oct 2 2012 12:29 AM
Merry Orthodox Christmas.htm HTML File 2.5 KB Oct 2 2012 12:28 AM
Mestizo Gangs Control the Suburbs.htm HTML File 2.6 KB Oct 2 2012 12:30 AM
Mestizos too violent for open debate, crowd control impossible.htm HTML File 2.7 KB Oct 2 2012 12:28 AM
Mexico Conquers Texas.htm HTML File 2.4 KB Oct 2 2012 12:33 AM
Mexico Ups the Ante in Conflict with American Blacks.htm HTML File 2.3 KB Oct 2 2012 12:33 AM
Michael Chertoff - 'Trust Us'.htm HTML File 5.8 KB Oct 2 2012 12:31 AM
Michael O'Meara - 2005-11-05 - Katrina's Intimation of the End - Afterthoughts on the Impending Catastrophe.txt Text File 15.7 KB Oct 2 2012 12:32 AM
Middle Class Families in Worse Shape Than Ever, Study Finds.htm HTML File 2.7 KB Oct 2 2012 12:31 AM
Milch.pdf PDF Document 2.3 MB Oct 2 2012 12:31 AM
MillerPuckette Book 06-2007.pdf PDF Document 1.9 MB Oct 2 2012 12:28 AM
minimanual.htm HTML File 28.5 KB Oct 2 2012 12:27 AM
Minnesotans Love Non-Whites.htm HTML File 2.2 KB Oct 2 2012 12:27 AM
Minnesota Shocker - Black Muslim Wins Primary.htm HTML File 3.6 KB Oct 2 2012 12:29 AM
minoritieslagdespitefcatgains.html HTML File 5.8 KB Oct 2 2012 12:33 AM
minoritytestscoregap.html HTML File 6.6 KB Oct 2 2012 12:34 AM
misc.html HTML File 31.5 KB Oct 2 2012 12:33 AM
Miscegenator Murders White 'Girlfriend' and Unborn Child.htm HTML File 3.3 KB Oct 2 2012 12:29 AM
missing.pdf PDF Document 1 MB Oct 2 2012 12:32 AM
Mission Fights Eastern European Sex Slave Traffic.htm HTML File 3.8 KB Oct 2 2012 12:33 AM
Mistrial for Accused Jewish Mafia Godfather.htm HTML File 3.4 KB Oct 2 2012 12:33 AM
mlk.pdf PDF Document 608.1 KB Oct 2 2012 12:32 AM
MLK101.pdf PDF Document 276.7 KB Oct 2 2012 12:33 AM
mlkday.pdf PDF Document 464.4 KB Oct 2 2012 12:33 AM
mlkflyer.pdf PDF Document 91.6 KB Oct 2 2012 12:30 AM
Mogadishu Redux -- The Irrepressible Genetics Of Simian Negroids.nws NWS File 111.1 KB Oct 2 2012 12:33 AM
Mom Gives Kids Dose O’ Diversity.htm HTML File 2.4 KB Oct 2 2012 12:31 AM
MoneyChangers.pdf PDF Document 172 KB Oct 2 2012 12:31 AM
More 'Racist' AIDS Statistics.htm HTML File 2.6 KB Oct 2 2012 12:31 AM
More Illegal Aliens Accused in Gang Rapes.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
More Jewish Mobsters Arriving.htm HTML File 7.7 KB Oct 2 2012 12:30 AM
morel.pdf PDF Document 342.2 KB Oct 2 2012 12:32 AM
More Legal Atrocities Against Serbian Whites.htm HTML File 9.5 KB Oct 2 2012 12:31 AM
Morell.pdf PDF Document 1.1 MB Oct 2 2012 12:31 AM
More on Reparations Unknown 18.8 KB Oct 2 2012 12:33 AM
More on the Cabbala.htm HTML File 7.9 KB Oct 2 2012 12:34 AM
More on the Orlando Sentinel's Campaign Against Free Speech and Thought.htm HTML File 7.4 KB Oct 2 2012 12:32 AM
MorrisDeesDivorcePapers.pdf PDF Document 33.4 KB Oct 2 2012 12:31 AM
MorrisDeesFactSheet.pdf PDF Document 203.1 KB Oct 2 2012 12:33 AM
MossadKillingMahcine.rtf RTF File 36.4 KB Oct 2 2012 12:28 AM
Mothers in Houston Join Katrina Altercation.htm HTML File 3.4 KB Oct 2 2012 12:31 AM
ms13_us.pdf PDF Document 295.9 KB Oct 2 2012 12:29 AM
MuadDib's Primer on the Jews.htm HTML File 71.9 KB Oct 2 2012 12:32 AM
Multicultural Jihad Wrecks Dutch Racial Harmony.htm HTML File 2.1 KB Oct 2 2012 12:27 AM
Multiracial Children Have More Psychological Problems.htm HTML File 4.4 KB Oct 2 2012 12:30 AM
Multiracialism and Conservatism.htm HTML File 21.3 KB Oct 2 2012 12:33 AM
mumiamurderer.pdf PDF Document 277.5 KB Oct 2 2012 12:31 AM
Museum Pulls 'Offensive' Artwork.htm HTML File 7.3 KB Oct 2 2012 12:34 AM
music.html HTML File 61.1 KB Oct 2 2012 12:33 AM
Muslim 'Tolerance' Boils Over in Egypt.htm HTML File 5.4 KB Oct 2 2012 12:31 AM
Muslims Back Down In Face of White 'Threat'.htm HTML File 6.5 KB Oct 2 2012 12:32 AM
My Big Biofuels Bet.htm HTML File 32.5 KB Oct 2 2012 12:34 AM
MY FAREWELL TO ISRAEL.htm HTML File 266.4 KB Oct 2 2012 12:31 AM
MyHonorIsLoyalty.pdf PDF Document 996.8 KB Oct 2 2012 12:31 AM
MyLifeOnThePlains.pdf PDF Document 732 KB Oct 2 2012 12:34 AM
Mystery of the mummies.htm HTML File 19.1 KB Oct 2 2012 12:30 AM
MythOfDiversity.pdf PDF Document 31 KB Oct 2 2012 12:31 AM
Myths, Misunderstandings, and Outright Lies - gold-confiscation-1933.htm HTML File 35.1 KB Oct 2 2012 12:31 AM
N.O. Cops Suspected of Stealing Up to 200 Cars.htm HTML File 3.8 KB Oct 2 2012 12:27 AM
Namibia, Africa - One Rape Every 60 Minutes.htm HTML File 1.9 KB Oct 2 2012 12:30 AM
Namibia - Tribe Demands German Reparations.htm HTML File 3.7 KB Oct 2 2012 12:33 AM
nascar.pdf PDF Document 60.5 KB Oct 2 2012 12:28 AM
Natallnews site.doc Microsoft Word Document 67 KB Oct 2 2012 12:31 AM
National Alliance Comic - Saga Of White Will.pdf PDF Document 17.2 MB Oct 2 2012 12:32 AM
National Alliance Speaks at Campus Mideast Forum.htm HTML File 10.2 KB Oct 2 2012 12:30 AM
National Vanguard - Just Say No to Illegal Immigrants.htm HTML File 9.2 KB Oct 2 2012 12:32 AM
National Vanguard Activist Wins Victory Against Censorship.htm HTML File 6.3 KB Oct 2 2012 12:31 AM
National Vanguard Magazine #129 - sample.pdf PDF Document 336.3 KB Oct 2 2012 12:33 AM
nationontrial.pdf PDF Document 540.4 KB Oct 2 2012 12:31 AM
nationontrial.rtf RTF File 290.6 KB Oct 2 2012 12:32 AM
NaturesEternalReligionOrig.pdf PDF Document 1.1 MB Oct 2 2012 12:28 AM
nazism - White Pride.htm HTML File 19.3 KB Oct 2 2012 12:31 AM
nc.photos.html HTML File 5.1 KB Oct 2 2012 12:31 AM
Nebilung.pdf PDF Document 491.8 KB Oct 2 2012 12:33 AM
Nebilung.rtf RTF File 598.8 KB Oct 2 2012 12:31 AM
Negro Accused of Spreading AIDS.htm HTML File 4 KB Oct 2 2012 12:32 AM
neonazi-chart.pdf PDF Document 69.6 KB Oct 2 2012 12:30 AM
ner.pdf PDF Document 1.1 MB Oct 2 2012 12:31 AM
Nerds Join Neo-Cons to Oppose National Vanguard.htm HTML File 4.5 KB Oct 2 2012 12:28 AM
Netherlands - Jihadi Plot Upsets Liberals.htm HTML File 3.2 KB Oct 2 2012 12:33 AM
Netherlands Braces for 'Jihad'.htm HTML File 2.1 KB Oct 2 2012 12:32 AM
nettinin04112006.html HTML File 113.3 KB Oct 2 2012 12:30 AM
New Africa.htm HTML File 4.4 KB Oct 2 2012 12:33 AM
NewAfricans.pdf PDF Document 35 KB Oct 2 2012 12:33 AM
New Book Helps White Families Become Prosperous.htm HTML File 2.9 KB Oct 2 2012 12:30 AM
New Charges for Lightfingers Tom.htm HTML File 2.9 KB Oct 2 2012 12:28 AM
New From FEMA - The Looter Relocation Program.htm HTML File 4.6 KB Oct 2 2012 12:31 AM
New Jersey - Jews Refuse to Vote in Churches.htm HTML File 7.5 KB Oct 2 2012 12:31 AM
New Jersey Girl Murdered and Dismembered By Mestizos.htm HTML File 3.1 KB Oct 2 2012 12:27 AM
New Jersey Icebergs and Whores.htm HTML File 24.8 KB Oct 2 2012 12:32 AM
New Jersey Rabbi Says Katrina Refugees Welcome in Utah.htm HTML File 3.2 KB Oct 2 2012 12:32 AM
New Orleans - Cops Join in Looting.htm HTML File 3.8 KB Oct 2 2012 12:29 AM
New Orleans - Second Amendment Suspended.htm HTML File 2.8 KB Oct 2 2012 12:32 AM
New Orleans - The Rise of 'Mighty Whitey'.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
New Orleans Africa-Like Well Before Hurricane Katrina.htm HTML File 5.1 KB Oct 2 2012 12:33 AM
New Orleans and 'The Gods of the Copybook Headings'.htm HTML File 27.3 KB Oct 2 2012 12:33 AM
New Orleans Chaos Reveals America on the Brink.htm HTML File 3.7 KB Oct 2 2012 12:31 AM
New Orleans Corrupt 'Down to the Bone,' Former Pol Charges.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
New Orleans Descends into Africa-like Savagery.htm HTML File 12.4 KB Oct 2 2012 12:33 AM
New Orleans gun confiscation is foolish and illegal.htm HTML File 7.2 KB Oct 2 2012 12:32 AM
New Orleans Parody Challenges System Media.htm HTML File 3.5 KB Oct 2 2012 12:34 AM
New Orleans Pays For Affirmative Action.htm HTML File 3.9 KB Oct 2 2012 12:32 AM
New Report Sheds Light on Hispanics in U.S..htm HTML File 3.8 KB Oct 2 2012 12:29 AM
New Sex Scandal Rocks Holy See.htm HTML File 5.2 KB Oct 2 2012 12:28 AM
Newsletter Sign Up.rar RAR Archive 601.2 KB Oct 2 2012 12:33 AM
newsletter_092005.pdf PDF Document 1.2 MB Oct 2 2012 12:28 AM
Newspaper Calls Mass-Murder 'Sad' Flier Distribution 'Despicable'.htm HTML File 4.3 KB Oct 2 2012 12:33 AM
Newsweek - Superlobbyist is Crooked.htm HTML File 2.8 KB Oct 2 2012 12:31 AM
New V-TV Video - Katrina Relief.htm HTML File 2.9 KB Oct 2 2012 12:33 AM
newyorkandhillaryschineserockets.html HTML File 4.9 KB Oct 2 2012 12:31 AM
New Yorkers to study about Israel.htm HTML File 14.9 KB Oct 2 2012 12:28 AM
New York Times - Chertoff Approved Abu Ghraib Interrogation Methods.htm HTML File 5.1 KB Oct 2 2012 12:33 AM
NFS_I.rar RAR Archive 89.9 MB Oct 2 2012 12:32 AM
Nick Griffin - The Race Murders the Media Ignore.htm HTML File 2.5 KB Oct 2 2012 12:32 AM
ninety_five_theses_on_the_holoca - Ninety Five Theses on the Holocaust.htm HTML File 35 KB Oct 2 2012 12:31 AM
NJ - Mestizo Cop Helped Drug Ring Say Officials.htm HTML File 4 KB Oct 2 2012 12:30 AM
NJ - New Black Panthers Come to Town.htm HTML File 4.4 KB Oct 2 2012 12:27 AM
NJ Ethics Office - Fagan Stole $400,000.htm HTML File 3.5 KB Oct 2 2012 12:33 AM
NJ Governor's Jewish Financial Angel - Also Clinton Backer, 'Holocaust' Appointee.htm HTML File 5.7 KB Oct 2 2012 12:28 AM
No, We're Not 'All Israelis Now'.htm HTML File 8.6 KB Oct 2 2012 12:28 AM
No Black Day in Jesse's Hometown.htm HTML File 4.1 KB Oct 2 2012 12:34 AM
No Debit Cards for White People.htm HTML File 2.4 KB Oct 2 2012 12:33 AM
noose.htm HTML File 11 KB Oct 2 2012 12:28 AM
Norman Language Flourishes in the Channel Islands.htm HTML File 5.8 KB Oct 2 2012 12:33 AM
North American Students Trained for 'Merger'.htm HTML File 4.1 KB Oct 2 2012 12:30 AM
Norway - 19,000 'Asylum' Seekers Evade Authorities.htm HTML File 2 KB Oct 2 2012 12:31 AM
Norwegian Patriots Demolish Sell-outs.htm HTML File 3.5 KB Oct 2 2012 12:31 AM
Norwegians Discover Joys of Islam.htm HTML File 2.7 KB Oct 2 2012 12:30 AM
Norwegian Teens Cool to 'Diversity'.htm HTML File 2.8 KB Oct 2 2012 12:30 AM
notes on Phenomenology.doc Microsoft Word Document 580 KB Oct 2 2012 12:31 AM
notguilty.pdf PDF Document 211.2 KB Oct 2 2012 12:33 AM
notguilty.rtf RTF File 142 KB Oct 2 2012 12:28 AM
Nov01.pdf PDF Document 909 KB Oct 2 2012 12:31 AM
Nov02.pdf PDF Document 1.8 MB Oct 2 2012 12:31 AM
Nov03.pdf PDF Document 871 KB Oct 2 2012 12:33 AM
Nov04.pdf PDF Document 634.2 KB Oct 2 2012 12:32 AM
nowarforisrael.pdf PDF Document 8.2 KB Oct 2 2012 12:32 AM
no_place_1.pdf PDF Document 802.2 KB Oct 2 2012 12:29 AM
nuremberg.pdf PDF Document 1.5 MB Oct 2 2012 12:30 AM
Nutty Professor Charged In Hate Crime Hoax.htm HTML File 4.2 KB Oct 2 2012 12:30 AM
nv_terrorfree.pdf PDF Document 571.3 KB Oct 2 2012 12:31 AM
nv_ussliberty.pdf PDF Document 156.3 KB Oct 2 2012 12:28 AM
nv_warforisrael.pdf PDF Document 113.9 KB Oct 2 2012 12:31 AM
NY Times Hit Hard as Controlled Media Take Continued Beating.htm HTML File 2.3 KB Oct 2 2012 12:31 AM
Oakland - Black-Yemeni Tension Ratcheted Up.htm HTML File 4.5 KB Oct 2 2012 12:28 AM
Oakland - Black Muslim Tensions Heightened.htm HTML File 7.5 KB Oct 2 2012 12:30 AM
Oakland - Blacks Loot Burned-Out Shell of Arab Store.htm HTML File 3.3 KB Oct 2 2012 12:27 AM
Oakland - Video Beating Victim Comes Forward.htm HTML File 3.3 KB Oct 2 2012 12:33 AM
Oakland Beating Video - Cops Baffled.htm HTML File 4 KB Oct 2 2012 12:30 AM
Oakland Update - Blacks Charged With Hate Crimes.htm HTML File 4.4 KB Oct 2 2012 12:28 AM
ocbpt.pdf PDF Document 3.3 MB Oct 2 2012 12:31 AM
ocbpt.rtf RTF File 5.8 MB Oct 2 2012 12:31 AM
ocbpt.zip ZIP Archive 3.5 MB Oct 2 2012 12:33 AM
Oct01.pdf PDF Document 905.4 KB Oct 2 2012 12:31 AM
Oct02.pdf PDF Document 1.4 MB Oct 2 2012 12:28 AM
Oct03.pdf PDF Document 1.1 MB Oct 2 2012 12:28 AM
Oct04.pdf PDF Document 705.3 KB Oct 2 2012 12:33 AM
October 7, 1571 - The Deliverance of Europe at Lepanto.htm HTML File 11 KB Oct 2 2012 12:30 AM
Of Course There Is an Israel Lobby.htm HTML File 3.1 KB Oct 2 2012 12:33 AM
Ohio - War Protest Turns Violent.htm HTML File 3.3 KB Oct 2 2012 12:27 AM
ohio college crime - 5349405.pdf PDF Document 30.3 KB Oct 2 2012 12:28 AM
ohn Lennon's 'Imagine' (revised).htm HTML File 7.5 KB Oct 2 2012 12:32 AM
Once We See Black We NEVER Go Back.htm HTML File 6 KB Oct 2 2012 12:31 AM
One Percent of Population Commits Half of Homicides.htm HTML File 120.4 KB Oct 2 2012 12:31 AM
OneSheaf.pdf PDF Document 549.2 KB Oct 2 2012 12:30 AM
On White Genocide.htm HTML File 11.8 KB Oct 2 2012 12:32 AM
opphack.htm HTML File 1.7 KB Oct 2 2012 12:31 AM
oppressed.pdf PDF Document 1.1 MB Oct 2 2012 12:31 AM
Optimized Krystal Planet Fall 2005 Catalog v3.pdf PDF Document 3.4 MB Oct 2 2012 12:33 AM
OriginsOfChristianity.pdf PDF Document 537.6 KB Oct 2 2012 12:31 AM
Over 75,000 AIDS Cases in New York City.htm HTML File 2.5 KB Oct 2 2012 12:33 AM
Pale Horsemen.pdf PDF Document 102.2 KB Oct 2 2012 12:27 AM
paleoamericanethnicdiversity.doc Microsoft Word Document 256 KB Oct 2 2012 12:33 AM
panels.pdf PDF Document 259.9 KB Oct 2 2012 12:31 AM
PassingOfGreatRace.pdf PDF Document 315.5 KB Oct 2 2012 12:33 AM
PassingOfTheGreatRace.rtf RTF File 438.5 KB Oct 2 2012 12:31 AM
Patric Ewing testifies he twice had oral sex at Gold Club.htm HTML File 28.7 KB Oct 2 2012 12:33 AM
Paul Jalsevac - The Inherent Racism Of Population Control.pdf PDF Document 380.7 KB Oct 2 2012 12:28 AM
Pay No Attention to the Jews Behind the Curtain—the Iron Curtain.htm HTML File 29.8 KB Oct 2 2012 12:28 AM
PC Desecration of Spanish Holy Site.htm HTML File 3.3 KB Oct 2 2012 12:33 AM
pearlharbor.pdf PDF Document 559 KB Oct 2 2012 12:27 AM
peltreport.pdf PDF Document 1.5 MB Oct 2 2012 12:33 AM
peltreport.rtf RTF File 2 MB Oct 2 2012 12:31 AM
Pennies.rtf RTF File 3.7 KB Oct 2 2012 12:34 AM
People Of Africa.pdf PDF Document 134.1 KB Oct 2 2012 12:33 AM
People Of Africa.zip ZIP Archive 29.1 KB Oct 2 2012 12:33 AM
Peterloo Massacre.htm HTML File 33.4 KB Oct 2 2012 12:32 AM
Petty Criminal Leaves Sarkozy Red-Faced.htm HTML File 3 KB Oct 2 2012 12:33 AM
Piezoelectric Windmill.pdf PDF Document 145.2 KB Oct 2 2012 12:29 AM
pipe.pdf PDF Document 1.6 MB Oct 2 2012 12:33 AM
pipermel.pdf PDF Document 1 MB Oct 2 2012 12:30 AM
Playstation Copying 4 Mac.pdf PDF Document 33.5 KB Oct 2 2012 12:28 AM
pledge.pdf PDF Document 722.5 KB Oct 2 2012 12:29 AM
Poignant Photo Strikes Reader.htm HTML File 2.7 KB Oct 2 2012 12:29 AM
PoisonousMushroom.pdf PDF Document 1 MB Oct 2 2012 12:30 AM
Poland Abruptly Cancels a Speech By Critic of the Jewish State.htm HTML File 3.2 KB Oct 2 2012 12:28 AM
Police - Hurricane Evacuees Kill Woman who Helped Them.htm HTML File 2.6 KB Oct 2 2012 12:31 AM
Police Demand Resignation of Black Commissioner.htm HTML File 2.3 KB Oct 2 2012 12:28 AM
Police Looting - Racial Realities Exposed in New Orleans.htm HTML File 4.6 KB Oct 2 2012 12:28 AM
Police Ordered to Stop Looters.htm HTML File 4.3 KB Oct 2 2012 12:31 AM
Polish-Americans Celebrate Harvest Festival.htm HTML File 3 KB Oct 2 2012 12:31 AM
Polish Father of US Cavalry Laid to Rest.htm HTML File 4.2 KB Oct 2 2012 12:30 AM
Political Correctness - The Scourge of Our Times.htm HTML File 3.9 KB Oct 2 2012 12:28 AM
Political Prisoners - In America.htm HTML File 8.3 KB Oct 2 2012 12:31 AM
Poll Shows Rising Tide of anti-Semitism on Eve of Holocaust Day.htm HTML File 3 KB Oct 2 2012 12:31 AM
Polls Show Opposition to Iraq War at All-Time High.htm HTML File 3.4 KB Oct 2 2012 12:30 AM
poster1470.jpg JPEG Image 113.1 KB Oct 2 2012 12:32 AM
Powerful Gains For Pro-Whites in Norwegian Elections.htm HTML File 3.3 KB Oct 2 2012 12:31 AM
Pre-Traumatic Stress Disorder-A Glimpse Into Israeli Collective Psychosis.htm HTML File 31.1 KB Oct 2 2012 12:34 AM
President Putin - 'Orthodox Christianity an Integral Part of Russian Culture'.htm HTML File 2 KB Oct 2 2012 12:28 AM
Pressure on Chertoff Builds.htm HTML File 3.1 KB Oct 2 2012 12:33 AM
Principal Negative Stereotypes Against European Americans.htm HTML File 7.4 KB Oct 2 2012 12:32 AM
printer.php.htm HTML File 5.2 KB Oct 2 2012 12:30 AM
prison_camps.pdf PDF Document 774.5 KB Oct 2 2012 12:31 AM
Pro-Zionist Televangelist Advocates Murder.htm HTML File 4.4 KB Oct 2 2012 12:32 AM
Pro and Con - NFL Star Allegedly Runs Over Teens in Stolen Car.htm HTML File 3.3 KB Oct 2 2012 12:28 AM
Progress Party Gets It Right.htm HTML File 2.7 KB Oct 2 2012 12:32 AM
Prophecy of the Seeress.htm HTML File 42 KB Oct 2 2012 12:31 AM
Protestants and Catholics Unite -- For a Brown Ireland.htm HTML File 3.9 KB Oct 2 2012 12:32 AM
Protests Loom in Far West, Washington.htm HTML File 3.7 KB Oct 2 2012 12:31 AM
ProtocolsOfZion.pdf PDF Document 215.8 KB Oct 2 2012 12:31 AM
PRreal.pdf PDF Document 446.3 KB Oct 2 2012 12:31 AM
Prussian Blue and the First Amendment.htm HTML File 8.1 KB Oct 2 2012 12:29 AM
PrussianismAndSocialism.pdf PDF Document 191.3 KB Oct 2 2012 12:34 AM
PUB637.pdf PDF Document 232.8 KB Oct 2 2012 12:29 AM
puddingrecipe .pdf PDF Document 1.2 MB Oct 2 2012 12:32 AM
Purchasing Precious Metals.htm HTML File 105.7 KB Oct 2 2012 12:29 AM
Putin's Cannibals 'Gaffe'.htm HTML File 2.5 KB Oct 2 2012 12:32 AM
Putin, the Patriot.htm HTML File 2.3 KB Oct 2 2012 12:29 AM
Putin - Those Who Bombed Serbia Should Pay Damages.htm HTML File 3 KB Oct 2 2012 12:33 AM
Putin Pilgrimage Strengthens Greco-Russian Links.htm HTML File 3.9 KB Oct 2 2012 12:28 AM
putting_israel_first.pdf PDF Document 1.1 MB Oct 2 2012 12:28 AM
QueenIsabella.pdf PDF Document 875.1 KB Oct 2 2012 12:31 AM
QueenIsabella.rtf RTF File 350.7 KB Oct 2 2012 12:34 AM
Questions of Preferential Treatment Raised in Sex Case.htm HTML File 4.2 KB Oct 2 2012 12:33 AM
Questions That May Not Be Asked About New Orleans.htm HTML File 4.5 KB Oct 2 2012 12:34 AM
QuotesAboutJews.pdf PDF Document 1.2 MB Oct 2 2012 12:33 AM
Rabbi calls for extermination of all Palestinian males.htm HTML File 5 KB Oct 2 2012 12:32 AM
Rabbis to Israeli Military - Kill More Non-Jews.htm HTML File 6.9 KB Oct 2 2012 12:33 AM
Race-based Medicine Confirms Genetic Differences.htm HTML File 2.5 KB Oct 2 2012 12:30 AM
race-mixing1.pdf PDF Document 856.4 KB Oct 2 2012 12:28 AM
Race and Murder.htm HTML File 5.3 KB Oct 2 2012 12:34 AM
Race Baiting as New Orleans Sinks.htm HTML File 6.4 KB Oct 2 2012 12:32 AM
racebook.doc Microsoft Word Document 683 KB Oct 2 2012 12:34 AM
RaceBook2.doc Microsoft Word Document 817.5 KB Oct 2 2012 12:31 AM
RaceEvolutionBehavior.pdf PDF Document 1.2 MB Oct 2 2012 12:31 AM
Race Hated - What Drives Jews.htm HTML File 8.8 KB Oct 2 2012 12:31 AM
Race in Ancient Egypt.htm HTML File 2.1 KB Oct 2 2012 12:33 AM
RaceMythsFromLeft.pdf PDF Document 39.7 KB Oct 2 2012 12:29 AM
RaceOfAncientEgypt.pdf PDF Document 258.8 KB Oct 2 2012 12:31 AM
Race_Evolution_Behavior.pdf PDF Document 2.7 MB Oct 2 2012 12:31 AM
race_traitor.pdf PDF Document 1.3 MB Oct 2 2012 12:28 AM
RachelCorrie.pdf PDF Document 129.4 KB Oct 2 2012 12:31 AM
Racial Battle-Lines Divide School.htm HTML File 3.5 KB Oct 2 2012 12:28 AM
Racial Explosion 60 Years On.htm HTML File 24.3 KB Oct 2 2012 12:29 AM
racialgapinschoolssplitsatownproudofdiversity.html HTML File 16.3 KB Oct 2 2012 12:32 AM
racialgapremainswideonmcasscores.html HTML File 9.1 KB Oct 2 2012 12:33 AM
Racialism versus Communitarianism.htm HTML File 25.8 KB Oct 2 2012 12:32 AM
Racial Media Jump on Katrina News.htm HTML File 3.6 KB Oct 2 2012 12:28 AM
RacialOriginOfJews.pdf PDF Document 51.7 KB Oct 2 2012 12:28 AM
Racial Reality and the New Orleans Nightmare.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
Racial Test Gap Remains Large in California.htm HTML File 2.6 KB Oct 2 2012 12:33 AM
Rad-ad.pdf PDF Document 123.4 KB Oct 2 2012 12:27 AM
Radical White Intellectual Predicts World-Altering Tempest.htm HTML File 9.8 KB Oct 2 2012 12:29 AM
Radio Station Urges 'Kill Tookie' Emails to Schwarzenegger.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
raffle2005.pdf PDF Document 451.1 KB Oct 2 2012 12:31 AM
rahowa.pdf PDF Document 1 MB Oct 2 2012 12:29 AM
Ramadan Madness Looms.htm HTML File 4.3 KB Oct 2 2012 12:28 AM
Rap King Shot in Florida.htm HTML File 3.2 KB Oct 2 2012 12:31 AM
Ravage_1.pdf PDF Document 445.8 KB Oct 2 2012 12:31 AM
Ravage_2.pdf PDF Document 654.7 KB Oct 2 2012 12:28 AM
READ-DavidLane's final addr.PDF PDF Document 21.5 KB Oct 2 2012 12:34 AM
Reading, Writing and Race.htm HTML File 230.1 KB Oct 2 2012 12:28 AM
README Open Letter- English.PDF PDF Document 20.8 KB Oct 2 2012 12:32 AM
Real Racial Supremacism.htm HTML File 24.3 KB Oct 2 2012 12:28 AM
Recent Events Show America is Changing.htm HTML File 3.9 KB Oct 2 2012 12:32 AM
Reflections Dental.rtf RTF File 3.1 KB Oct 2 2012 12:31 AM
Refugee Numbers On the Rise.htm HTML File 2.1 KB Oct 2 2012 12:33 AM
Religious Group Flagellate Selves Over 'Reparations'.htm HTML File 7.2 KB Oct 2 2012 12:28 AM
Remember the Turkish Genocide of the Pontic Greeks.htm HTML File 6.2 KB Oct 2 2012 12:33 AM
renaissance.html HTML File 41.5 KB Oct 2 2012 12:27 AM
Renewable Energy Home Products Brochure.pdf PDF Document 935.5 KB Oct 2 2012 12:28 AM
Report - Cannibalism in New Orleans.htm HTML File 2.7 KB Oct 2 2012 12:32 AM
reportblackslikelytobespecialedstudents.html HTML File 1.6 KB Oct 2 2012 12:27 AM
Report Illegal Aliens - status_report.htm HTML File 39.5 KB Oct 2 2012 12:32 AM
Republicans Back Pro-Homosexual 'Hate Crimes' Expansion.htm HTML File 3.4 KB Oct 2 2012 12:30 AM
resistancetoday.htm HTML File 80.2 KB Oct 2 2012 12:34 AM
Resisting Defamation - Principal Negative Stereotypes Against European Americans.htm HTML File 1.7 KB Oct 2 2012 12:31 AM
Resisting Defamatory Anti-White Language.htm HTML File 15.9 KB Oct 2 2012 12:31 AM
Restaurant Owner_ NOT GUILTY for squishing savage Shantavious!.nws NWS File 2.1 KB Oct 2 2012 12:33 AM
Restoring The Small Farm.htm HTML File 55.5 KB Oct 2 2012 12:27 AM
RESULTS OF MINNESOTA TRANSRACIAL ADOPTION STUDY.htm HTML File 9.9 KB Oct 2 2012 12:32 AM
RethinkingImmigration.pdf PDF Document 305.8 KB Oct 2 2012 12:34 AM
RevisionismConsequences.pdf PDF Document 200.9 KB Oct 2 2012 12:31 AM
revisionistpamphlets.pdf PDF Document 481.4 KB Oct 2 2012 12:31 AM
revisionistpamphlets.rtf RTF File 354.8 KB Oct 2 2012 12:30 AM
RevoltAgainstCivilization.pdf PDF Document 488.6 KB Oct 2 2012 12:33 AM
RFP_SFP-App.pdf PDF Document 679.1 KB Oct 2 2012 12:31 AM
Rhode Island - Cops Catch Illegals at Dem Chair's House.htm HTML File 2.9 KB Oct 2 2012 12:33 AM
RightAndWrongRacism.pdf PDF Document 43 KB Oct 2 2012 12:28 AM
rights.pdf PDF Document 47.5 KB Oct 2 2012 12:27 AM
RisingTideOfColor.pdf PDF Document 545.1 KB Oct 2 2012 12:29 AM
RitualMurderInvestigation.pdf PDF Document 4.3 MB Oct 2 2012 12:30 AM
RitualMurderMythOrReality.pdf PDF Document 245.9 KB Oct 2 2012 12:32 AM
Robert S. Griffin - 2004-09-05 - William Pierce - A Reminiscence.htm HTML File 34.4 KB Oct 2 2012 12:34 AM
RoboticsUIUC_CropProtectionConf.pdf PDF Document 494 KB Oct 2 2012 12:33 AM
Rockers Demand Recognition of Armenian Genocide.htm HTML File 7.2 KB Oct 2 2012 12:30 AM
Rommel.pdf PDF Document 4.8 MB Oct 2 2012 12:32 AM
Rosa Brooks - Criticize Israel - You're an Anti-Semite.htm HTML File 45.1 KB Oct 2 2012 12:28 AM
RosenbergMemoirs.pdf PDF Document 705.2 KB Oct 2 2012 12:33 AM
rtc_1-01.html HTML File 21.5 KB Oct 2 2012 12:30 AM
rtc_1-02.html HTML File 57.9 KB Oct 2 2012 12:33 AM
rtc_1-03.html HTML File 51 KB Oct 2 2012 12:33 AM
rtc_1-04.html HTML File 26.1 KB Oct 2 2012 12:31 AM
rtc_1-05.html HTML File 61 KB Oct 2 2012 12:28 AM
rtc_2-06.html HTML File 13 KB Oct 2 2012 12:28 AM
rtc_2-07.html HTML File 29.4 KB Oct 2 2012 12:30 AM
rtc_2-08.html HTML File 37.4 KB Oct 2 2012 12:30 AM
rtc_2-09.html HTML File 37.5 KB Oct 2 2012 12:28 AM
rtc_3-10.html HTML File 17.2 KB Oct 2 2012 12:28 AM
rtc_3-11.html HTML File 96.7 KB Oct 2 2012 12:32 AM
rtc_3-12.html HTML File 17.8 KB Oct 2 2012 12:33 AM
rtc_intro.html HTML File 22.2 KB Oct 2 2012 12:28 AM
rtc_preface.html HTML File 4.5 KB Oct 2 2012 12:32 AM
RulesForLivingWithPeople.pdf PDF Document 16.7 KB Oct 2 2012 12:29 AM
Rural Traditions of the Pennsylvania Dutch Still Strong.htm HTML File 4.9 KB Oct 2 2012 12:32 AM
Rush-un.pdf PDF Document 82 KB Oct 2 2012 12:32 AM
Russia - Jewish Group Worried About Russian Patriots.htm HTML File 3.3 KB Oct 2 2012 12:33 AM
Russia - Sophisticated Sex Slave Operation Uncovered.htm HTML File 6.1 KB Oct 2 2012 12:33 AM
Russian State Duma Denounces Armenian Genocide.htm HTML File 2.1 KB Oct 2 2012 12:28 AM
Russian Wealth in Hands of Jews - One Hundred Own Quarter of Wealth as Russians Starve.htm HTML File 6.8 KB Oct 2 2012 12:31 AM
Russia Ponders Tax on Childlessness.htm HTML File 3.1 KB Oct 2 2012 12:32 AM
rvtr.pdf PDF Document 929.6 KB Oct 2 2012 12:33 AM
rwp_06_011_walt.pdf PDF Document 1.2 MB Oct 2 2012 12:29 AM
sacred_cavern.zip ZIP Archive 422.5 KB Oct 2 2012 12:31 AM
SaddestStory.pdf PDF Document 7.2 KB Oct 2 2012 12:30 AM
sales.html HTML File 30.1 KB Oct 2 2012 12:31 AM
San Diego Whites Protest Ethnic Cleansing.htm HTML File 3.2 KB Oct 2 2012 12:33 AM
Sarah_Knox_Taylor_davis.pdf PDF Document 24.1 KB Oct 2 2012 12:31 AM
SATGapBW.pdf PDF Document 314.9 KB Oct 2 2012 12:31 AM
Savages.pdf PDF Document 987.5 KB Oct 2 2012 12:34 AM
savitri-pdf.zip ZIP Archive 1.3 MB Oct 2 2012 12:33 AM
saynotoextinction.pdf PDF Document 25.9 KB Oct 2 2012 12:29 AM
scamway.pdf PDF Document 1.7 MB Oct 2 2012 12:29 AM
School Officials Look the Other Way When Whites are Abused.htm HTML File 7.5 KB Oct 2 2012 12:29 AM
schoolsfacecivilrightsprobe.html HTML File 5.9 KB Oct 2 2012 12:28 AM
Science Strikes Back.htm HTML File 86.9 KB Oct 2 2012 12:31 AM
Scotland - Poseurs Headed for Kneecapping.htm HTML File 6 KB Oct 2 2012 12:32 AM
Scotland - Race Killing Case Opens.htm HTML File 3.3 KB Oct 2 2012 12:33 AM
Seattle Test Scores Anguish.htm HTML File 2.6 KB Oct 2 2012 12:28 AM
secondchance.pdf PDF Document 130.4 KB Oct 2 2012 12:30 AM
Secret Service agents say Cheney was drunk when he shot lawyer.htm HTML File 7.4 KB Oct 2 2012 12:33 AM
SecretsOfFedReserve.pdf PDF Document 461.2 KB Oct 2 2012 12:28 AM
security_911_2005color.pdf PDF Document 216 KB Oct 2 2012 12:30 AM
send_the_goyim.pdf PDF Document 843.6 KB Oct 2 2012 12:29 AM
Sep01.pdf PDF Document 1.4 MB Oct 2 2012 12:28 AM
Sep02.pdf PDF Document 1.6 MB Oct 2 2012 12:33 AM
Sep03.pdf PDF Document 675.9 KB Oct 2 2012 12:34 AM
Sep04.pdf PDF Document 558.9 KB Oct 2 2012 12:34 AM
Sex Offenders Slip Radar.htm HTML File 2.1 KB Oct 2 2012 12:28 AM
Sex Rabbi - 'I'll Debate David Duke'.htm HTML File 2.8 KB Oct 2 2012 12:28 AM
Sex Trade Flourishing in 'Holy Land'.htm HTML File 2 KB Oct 2 2012 12:31 AM
shadow.pdf PDF Document 632.6 KB Oct 2 2012 12:30 AM
shakedown2.pdf PDF Document 1 MB Oct 2 2012 12:30 AM
shamiressays.pdf PDF Document 875.8 KB Oct 2 2012 12:29 AM
shamiressays.rtf RTF File 1018.3 KB Oct 2 2012 12:33 AM
Sharon - The Al Sharpton of the Middle East.htm HTML File 5.8 KB Oct 2 2012 12:31 AM
ShatteringMythOfRacism.pdf PDF Document 1.6 MB Oct 2 2012 12:28 AM
Shaun Walker - What Happened to Normal Behavior - 10-08-2005.pdf PDF Document 247.3 KB Oct 2 2012 12:33 AM
shelby - Terrorism In South Africa.htm HTML File 17.3 KB Oct 2 2012 12:28 AM
shirts.html HTML File 17.6 KB Oct 2 2012 12:32 AM
Shmuley loses it.htm HTML File 34.2 KB Oct 2 2012 12:30 AM
shongum_001-020.doc Microsoft Word Document 788 KB Oct 2 2012 12:32 AM
shongum_021-050.doc Microsoft Word Document 343 KB Oct 2 2012 12:27 AM
shongum_051-070.doc Microsoft Word Document 493.5 KB Oct 2 2012 12:28 AM
shongum_071-096.doc Microsoft Word Document 323 KB Oct 2 2012 12:31 AM
shongum_097-122.doc Microsoft Word Document 228.5 KB Oct 2 2012 12:33 AM
shongum_123-150.doc Microsoft Word Document 786 KB Oct 2 2012 12:28 AM
shongum_151-168.doc Microsoft Word Document 552 KB Oct 2 2012 12:27 AM
shongum_BIBLIOG_REFS.doc Microsoft Word Document 20.5 KB Oct 2 2012 12:30 AM
shongum_preface.doc Microsoft Word Document 332.5 KB Oct 2 2012 12:31 AM
shongum_preface.xhtml HTML File 26.2 KB Oct 2 2012 12:28 AM
shufeldt.pdf PDF Document 4.9 MB Oct 2 2012 12:29 AM
sikorski.pdf PDF Document 937.3 KB Oct 2 2012 12:31 AM
SilentJew.pdf PDF Document 35.1 KB Oct 2 2012 12:28 AM
Silver - Why You Should Own It.htm HTML File 5.9 KB Oct 2 2012 12:31 AM
SimpleArithmetic.pdf PDF Document 14.6 KB Oct 2 2012 12:33 AM
Singapore Bloggers Latest Victims of Multicultural Intolerance.htm HTML File 3.6 KB Oct 2 2012 12:31 AM
Sinn Fein Touts for Third World Ireland at Westminster.htm HTML File 6.2 KB Oct 2 2012 12:31 AM
Sir Gawain and the Green Knight - Indo-European Archetypal Myth.htm HTML File 20.1 KB Oct 2 2012 12:27 AM
sl.pdf PDF Document 1 MB Oct 2 2012 12:34 AM
Slave Account - Fiction.htm HTML File 3.3 KB Oct 2 2012 12:30 AM
SlaveryWhatReallyHappened.pdf PDF Document 22.1 KB Oct 2 2012 12:31 AM
SmartFractionTheory.pdf PDF Document 77.7 KB Oct 2 2012 12:31 AM
smash.pdf PDF Document 55.5 KB Oct 2 2012 12:31 AM
smell_the_blood.pdf PDF Document 846.5 KB Oct 2 2012 12:33 AM
SocialDarwinism.pdf PDF Document 15.7 KB Oct 2 2012 12:27 AM
SocratesVsJesus.pdf PDF Document 104.5 KB Oct 2 2012 12:34 AM
So Long Tookie.htm HTML File 6 KB Oct 2 2012 12:34 AM
solzhenitsyn photo.jpg JPEG Image 14.4 KB Oct 2 2012 12:30 AM
Some Comments on 'Racism'.htm HTML File 6.3 KB Oct 2 2012 12:33 AM
Some Jews Still Attacking Mel Gibson.htm HTML File 5 KB Oct 2 2012 12:28 AM
Soros 'An Extremely Evil Person'.htm HTML File 2.9 KB Oct 2 2012 12:27 AM
So You Think You're a White Anti-Racist.htm HTML File 6.1 KB Oct 2 2012 12:29 AM
So You Thought the Mob Was Run by Italians.htm HTML File 18.1 KB Oct 2 2012 12:28 AM
SP27.pdf PDF Document 159 Bytes Oct 2 2012 12:34 AM
specialtreatment.pdf PDF Document 6.8 MB Oct 2 2012 12:27 AM
Specific Sites Excluded from Google.fr and or Google.de.htm HTML File 58.3 KB Oct 2 2012 12:31 AM
Spelling Used TV to Push Homosexual Agenda.htm HTML File 5.1 KB Oct 2 2012 12:28 AM
spiderjew.jpg JPEG Image 6.9 KB Oct 2 2012 12:34 AM
Spoof - Byzantine Emperor Apologizes to Muslims For Quote.htm HTML File 4.3 KB Oct 2 2012 12:31 AM
srebrenica.pdf PDF Document 15.1 MB Oct 2 2012 12:30 AM
ssracetheory.pdf PDF Document 2.7 MB Oct 2 2012 12:29 AM
St. George and the Harridan.htm HTML File 5.2 KB Oct 2 2012 12:33 AM
St. Petersburg, FL - ethnic.htm HTML File 22.9 KB Oct 2 2012 12:34 AM
Stab in the Back - Israel’s Attack on the USS Liberty.htm HTML File 10.3 KB Oct 2 2012 12:31 AM
Stalin’s Willing Executioners - 2005-11-05.txt Text File 22.8 KB Oct 2 2012 12:32 AM
Stalin’s Willing Executioners.txt Text File 37 KB Oct 2 2012 12:31 AM
Stanford - Racial Groupings Match Genetic Profiles.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
State Dept. Provides Preview of Life in Aztlan.htm HTML File 24 KB Oct 2 2012 12:29 AM
stayawayfromblackdoctors.html HTML File 5.1 KB Oct 2 2012 12:32 AM
Steve E Romer - 2006-04-18 - Make Illegal Aliens Felons - That's Not Enough.htm HTML File 23.6 KB Oct 2 2012 12:28 AM
Steven E. Roper - 2003-10-04 - Beyond IQ.txt Text File 9.3 KB Oct 2 2012 12:33 AM
Steven E. Roper - 2004-12-11 - White People's Music; White People's Religion.txt Text File 18.3 KB Oct 2 2012 12:31 AM
Steven E Romer - 2006-02-14 - Tiny Differences, Through Time, are Everything.htm HTML File 30.2 KB Oct 2 2012 12:28 AM
Stopping the Unstoppable.htm HTML File 23.8 KB Oct 2 2012 12:33 AM
Stop White Genocide.htm HTML File 26.6 KB Oct 2 2012 12:31 AM
StrangeLifeOfNikolaTesla.pdf PDF Document 284.3 KB Oct 2 2012 12:30 AM
Strangers Among Us.htm HTML File 55.6 KB Oct 2 2012 12:34 AM
Strong Showing for BNP.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
stupidwhitemen.pdf PDF Document 1.4 MB Oct 2 2012 12:27 AM
stylesheet.css Stylesheet 5.1 KB Oct 2 2012 12:31 AM
Subverting the Disney Legacy - Michael Eisner.htm HTML File 16.3 KB Oct 2 2012 12:30 AM
Supermob - Sidney Korshak and His Criminal Associates.htm HTML File 5 KB Oct 2 2012 12:29 AM
Support Freedom of Speech - Wear the Wristband.htm HTML File 5 KB Oct 2 2012 12:33 AM
Surrounded by Jews, Bush Blasts Mahathir, Says He's 'Wrong' About Jewish Power.htm HTML File 3.3 KB Oct 2 2012 12:28 AM
Survey - Israel is Number One Threat to World Peace.htm HTML File 5.8 KB Oct 2 2012 12:31 AM
Suspect - My Job Is 'Taking White People's Cars'.htm HTML File 11.5 KB Oct 2 2012 12:32 AM
Sustainable_Design_Goals.pdf PDF Document 485.6 KB Oct 2 2012 12:31 AM
swazi.ttf TTF File 46.1 KB Oct 2 2012 12:32 AM
Swedes Arrest Alleged 'Anti-Fascist' Terrorist.htm HTML File 3.8 KB Oct 2 2012 12:34 AM
Swedes Embrace Inquisition.htm HTML File 4.6 KB Oct 2 2012 12:27 AM
Swiss Banks and the Jews - What Happened to the Extra Billion.htm HTML File 11.9 KB Oct 2 2012 12:28 AM
Synagogue Desecration Shocks London.htm HTML File 7.3 KB Oct 2 2012 12:31 AM
Syrians Snuff Islamist Attack on US.htm HTML File 4.5 KB Oct 2 2012 12:28 AM
t.zip ZIP Archive 2.1 MB Oct 2 2012 12:34 AM
Take Me to Your Moron.htm HTML File 4.8 KB Oct 2 2012 12:28 AM
TakeYourChoice.pdf PDF Document 575.2 KB Oct 2 2012 12:31 AM
TaliessinThroughLoegres.pdf PDF Document 96.8 KB Oct 2 2012 12:28 AM
Tampa - When Whites Gather.htm HTML File 7.5 KB Oct 2 2012 12:30 AM
Tampa Summer Solstice Festival.htm HTML File 2.6 KB Oct 2 2012 12:34 AM
Targetmaster.pdf PDF Document 27.8 KB Oct 2 2012 12:32 AM
TaxonomicConstruct.pdf PDF Document 341.1 KB Oct 2 2012 12:33 AM
teachertestshowswideracialgap.html HTML File 6.3 KB Oct 2 2012 12:30 AM
Television Pioneer Elma Farnsworth Dies at 98.htm HTML File 9.5 KB Oct 2 2012 12:31 AM
TerrorFree.pdf PDF Document 505.3 KB Oct 2 2012 12:31 AM
testscoreprobesought.html HTML File 6.4 KB Oct 2 2012 12:30 AM
Texas Papers Play Up 'Racial' Quotes by Candidate Friedman.htm HTML File 2.8 KB Oct 2 2012 12:30 AM
TextbookOfTheUniverse.pdf PDF Document 12.3 MB Oct 2 2012 12:33 AM
tfh.pdf PDF Document 3.7 MB Oct 2 2012 12:30 AM
tfh.zip ZIP Archive 2.4 MB Oct 2 2012 12:30 AM
That Which is Good, Shall be Called Evil.htm HTML File 9.3 KB Oct 2 2012 12:33 AM
thcov.pdf PDF Document 812.1 KB Oct 2 2012 12:28 AM
The 'Holocaust' Is A Typical Zionist Myth.htm HTML File 49 KB Oct 2 2012 12:28 AM
THE 100% SOLUTION.pdf PDF Document 85.7 KB Oct 2 2012 12:28 AM
The ADL, Jesus, and Anti-Semitism.htm HTML File 4.3 KB Oct 2 2012 12:33 AM
The American Nation.htm HTML File 19.4 KB Oct 2 2012 12:31 AM
The American Nation Part II.htm HTML File 17.5 KB Oct 2 2012 12:34 AM
The Anthrax Murders - The Israeli Connection, part 1.htm HTML File 25 KB Oct 2 2012 12:31 AM
The Anthrax Murders - The Israeli Connection, part 2.htm HTML File 23.6 KB Oct 2 2012 12:32 AM
The Anti-White Gangsters of Ulster.htm HTML File 4.4 KB Oct 2 2012 12:28 AM
TheAntichrist.pdf PDF Document 164.5 KB Oct 2 2012 12:32 AM
THE ARYANS, OR NOBLES.htm HTML File 11.2 KB Oct 2 2012 12:34 AM
The Barack Obama Myth.htm HTML File 7.5 KB Oct 2 2012 12:28 AM
The BBC's One Way Racism.htm HTML File 3.3 KB Oct 2 2012 12:33 AM
The Beast as Saint - The Truth About 'Martin Luther King'.htm HTML File 22.8 KB Oct 2 2012 12:33 AM
The Biological Puzzle of Jewish Behavior.htm HTML File 12.2 KB Oct 2 2012 12:30 AM
The Broken Wall - newspaper coverage of its advertisers.txt Text File 23.9 KB Oct 2 2012 12:29 AM
thecause.pdf PDF Document 166 KB Oct 2 2012 12:29 AM
The Changing Face of AIDS.htm HTML File 17.8 KB Oct 2 2012 12:32 AM
THE CHINK IN OUR ARMOR.htm HTML File 19.9 KB Oct 2 2012 12:30 AM
The Christ-Killers Today.htm HTML File 22 KB Oct 2 2012 12:32 AM
The Color Of Crime And The New Orleans Nightmare.htm HTML File 13.2 KB Oct 2 2012 12:27 AM
TheComingBattle.pdf PDF Document 728.1 KB Oct 2 2012 12:30 AM
The Confederate Defeat, The Fall Of New Orleans.htm HTML File 44 KB Oct 2 2012 12:31 AM
The Congo's Atrocious Secret.htm HTML File 2.1 KB Oct 2 2012 12:34 AM
thecoxreport.html HTML File 10 KB Oct 2 2012 12:33 AM
The Darkening Face of AIDS.htm HTML File 1.7 KB Oct 2 2012 12:34 AM
The Dark Side of the Anti-Defamation League, part 1.htm HTML File 4.3 KB Oct 2 2012 12:31 AM
The Dark Side of the Anti-Defamation League, part 2.htm HTML File 3.2 KB Oct 2 2012 12:30 AM
The Dark Side of the Anti-Defamation League, part 3.htm HTML File 3.2 KB Oct 2 2012 12:33 AM
The Dark Side of the Anti-Defamation League, part 4.htm HTML File 3.3 KB Oct 2 2012 12:33 AM
The Dark Side of the Anti-Defamation League, part 5.htm HTML File 3.9 KB Oct 2 2012 12:28 AM
The Dark Side of the Anti-Defamation League, part 6.htm HTML File 3.7 KB Oct 2 2012 12:33 AM
The Dark Side of the Anti-Defamation League, part 7.htm HTML File 4.2 KB Oct 2 2012 12:31 AM
The Dark Side of the Anti-Defamation League, part 8.htm HTML File 3.9 KB Oct 2 2012 12:34 AM
The De-Zionization of the American Mind.htm HTML File 3.7 KB Oct 2 2012 12:30 AM
The Deadly Twins.htm HTML File 10.8 KB Oct 2 2012 12:33 AM
The Destruction of White Youth.htm HTML File 3 KB Oct 2 2012 12:33 AM
The Dog Gone Asians.htm HTML File 4.6 KB Oct 2 2012 12:31 AM
The Drunken Truth.htm HTML File 18 KB Oct 2 2012 12:30 AM
The Dutch Say 'Nee!'.htm HTML File 4.8 KB Oct 2 2012 12:28 AM
The Eternal Value of Privacy.htm HTML File 24.5 KB Oct 2 2012 12:30 AM
The EU Constitution.htm HTML File 6 KB Oct 2 2012 12:27 AM
The Evidence of the Prussian Blue.htm HTML File 14.5 KB Oct 2 2012 12:31 AM
The Factory Farms of Jewish Publishing.htm HTML File 14.8 KB Oct 2 2012 12:30 AM
The FCC Scandal.htm HTML File 3.8 KB Oct 2 2012 12:27 AM
The Forbidden Srebrenica Report - Something The Neo-cons Don't Want You To See.htm HTML File 3.9 KB Oct 2 2012 12:32 AM
The Fraud of Neoconservative 'Anti-Communism'.htm HTML File 19.4 KB Oct 2 2012 12:32 AM
The Gateway.htm HTML File 19.6 KB Oct 2 2012 12:31 AM
The Governors Declare An Emergency - Who Cares If They’re Sincere.htm HTML File 3.2 KB Oct 2 2012 12:29 AM
The Hard Edge of Hatred.htm HTML File 11 KB Oct 2 2012 12:32 AM
The Hidden History of 9-11-2001.htm HTML File 129.8 KB Oct 2 2012 12:28 AM
The Hidden Tyranny.txt Text File 49.5 KB Oct 2 2012 12:28 AM
THE HIGH COST OF VENGEANCE.rtf RTF File 906.3 KB Oct 2 2012 12:33 AM
The Hollywood Big Lie.htm HTML File 5.9 KB Oct 2 2012 12:28 AM
The Holocaust Controversy - The Case For Open Debate.htm HTML File 20.8 KB Oct 2 2012 12:33 AM
The Holy Man and the Ho.htm HTML File 4.8 KB Oct 2 2012 12:27 AM
TheInternationalJew.pdf PDF Document 2.4 MB Oct 2 2012 12:30 AM
TheJewAsCriminal.pdf PDF Document 511.8 KB Oct 2 2012 12:31 AM
The Jewish Declaration of War.htm HTML File 33.2 KB Oct 2 2012 12:31 AM
THE JEWS AND THE CONCENTRATION CAMPS - A FACTUAL APPRAISAL BY THE RED.htm HTML File 16.2 KB Oct 2 2012 12:30 AM
The Jew Who Fled Rio.htm HTML File 18.5 KB Oct 2 2012 12:34 AM
The Judas Goats.htm HTML File 31.6 KB Oct 2 2012 12:31 AM
TheJungle.pdf PDF Document 815.9 KB Oct 2 2012 12:32 AM
The Kwanzaa Hoax.htm HTML File 13.1 KB Oct 2 2012 12:32 AM
The Last Straw - Jewish Death Squads in America.htm HTML File 18.1 KB Oct 2 2012 12:31 AM
The Leo Frank case.htm HTML File 56.9 KB Oct 2 2012 12:31 AM
The Liberty Tree.htm HTML File 6 KB Oct 2 2012 12:31 AM
The Love of Ages.htm HTML File 21.9 KB Oct 2 2012 12:31 AM
The Meaning of the Candy Cane.txt Text File 468 Bytes Oct 2 2012 12:31 AM
The Middle East Initiative.htm HTML File 18.3 KB Oct 2 2012 12:29 AM
The Missiles at Ground Zero.htm HTML File 20.8 KB Oct 2 2012 12:31 AM
The Most Corrupt Member of Congress.htm HTML File 2.3 KB Oct 2 2012 12:31 AM
The Neo-Genocidists.htm HTML File 15.2 KB Oct 2 2012 12:34 AM
The New Minority.htm HTML File 4.9 KB Oct 2 2012 12:28 AM
The Next Victims of Islamic Terror.htm HTML File 2.9 KB Oct 2 2012 12:28 AM
The Officially Sanctioned Invasion of Greece.htm HTML File 21.6 KB Oct 2 2012 12:34 AM
The Origins Of 'Racism' - The Curious Beginnings Of A Useless Word.htm HTML File 53.2 KB Oct 2 2012 12:32 AM
The Origins of the White Man - Part I.htm HTML File 82.7 KB Oct 2 2012 12:31 AM
The Origins of the White Man - Part II.htm HTML File 85.1 KB Oct 2 2012 12:34 AM
The Origins of the Word 'Racism'.htm HTML File 18.6 KB Oct 2 2012 12:33 AM
ThePhotographersRight.pdf PDF Document 53.8 KB Oct 2 2012 12:27 AM
The Pope Must Die.htm HTML File 3.9 KB Oct 2 2012 12:32 AM
The Price White Americans Pay - Never Forget the Hmong Massacre.htm HTML File 12.7 KB Oct 2 2012 12:33 AM
The Price White Americans Pay - Never Forget the Hmong Massacre.pdf PDF Document 320 KB Oct 2 2012 12:34 AM
thequietscourge.html HTML File 5 KB Oct 2 2012 12:31 AM
The Racial Ideology of Empire.htm HTML File 122.3 KB Oct 2 2012 12:31 AM
The Rednecks Did It!.htm HTML File 3.6 KB Oct 2 2012 12:32 AM
There is No Freedom Without Free Speech.htm HTML File 14.3 KB Oct 2 2012 12:31 AM
There is No Ghetto Pass.htm HTML File 3.6 KB Oct 2 2012 12:31 AM
There is no place for such a regime in the family of nations.txt Text File 4.1 KB Oct 2 2012 12:30 AM
The Resurrector.pdf PDF Document 135.9 KB Oct 2 2012 12:31 AM
The Rise of the BNP.htm HTML File 3.9 KB Oct 2 2012 12:34 AM
The Self-Evident Lessons of Madrid.htm HTML File 8.3 KB Oct 2 2012 12:31 AM
The Shame of Being an American.htm HTML File 20.2 KB Oct 2 2012 12:28 AM
The Shocking Story of Approved Killing in Mississippi.htm HTML File 37.7 KB Oct 2 2012 12:29 AM
The Struggle for Caucasia.htm HTML File 15.8 KB Oct 2 2012 12:33 AM
The Symbiants.htm HTML File 8.3 KB Oct 2 2012 12:27 AM
thetanserstudy.html HTML File 7.8 KB Oct 2 2012 12:32 AM
The Tapes the Hague Tribunal Hasn't Shown - Muslim Terrorists Massacring Serbs.htm HTML File 2.7 KB Oct 2 2012 12:31 AM
The Truth About Slavery.htm HTML File 23.4 KB Oct 2 2012 12:34 AM
The Truth About Tuskegee.htm HTML File 29 KB Oct 2 2012 12:29 AM
The United Israeli Emirates of North America.htm HTML File 5.8 KB Oct 2 2012 12:32 AM
The United States of Barbarism.htm HTML File 3.9 KB Oct 2 2012 12:34 AM
TheWatchdogs.pdf PDF Document 807.5 KB Oct 2 2012 12:28 AM
TheWayForward.pdf PDF Document 579.5 KB Oct 2 2012 12:32 AM
The Weird Wild World of the Zionist Right.htm HTML File 5.8 KB Oct 2 2012 12:30 AM
The Weird World of Kwanzaa and Other African Hoaxes.htm HTML File 9.3 KB Oct 2 2012 12:33 AM
The Whitewashing of Ariel Sharon.htm HTML File 3.6 KB Oct 2 2012 12:33 AM
The Winds of Change.htm HTML File 29.3 KB Oct 2 2012 12:28 AM
The World is His China Shop and His Shills Make Excuses.htm HTML File 9.7 KB Oct 2 2012 12:27 AM
The Wrath of Ka.htm HTML File 5.8 KB Oct 2 2012 12:34 AM
They Want Our Kids.htm HTML File 2.2 KB Oct 2 2012 12:33 AM
theywereslaves.pdf PDF Document 3.3 MB Oct 2 2012 12:28 AM
theywereslaves.rtf RTF File 2.4 MB Oct 2 2012 12:28 AM
The Zambotistas and the Moslemoids versus the Neo-Cons.htm HTML File 3.6 KB Oct 2 2012 12:34 AM
The_Jews_in_England_part2.html HTML File 38.3 KB Oct 2 2012 12:28 AM
the_talmud.pdf PDF Document 199.5 KB Oct 2 2012 12:33 AM
the_truth.pdf PDF Document 280.2 KB Oct 2 2012 12:34 AM
thinking.htm HTML File 24.9 KB Oct 2 2012 12:33 AM
ThinkingAboutNeocons.pdf PDF Document 147.4 KB Oct 2 2012 12:30 AM
ThisTimeTheWorld.pdf PDF Document 594.1 KB Oct 2 2012 12:33 AM
ThisTimeTheWorld.rtf RTF File 1.1 MB Oct 2 2012 12:27 AM
This Will Come Back to Haunt Us.htm HTML File 9.6 KB Oct 2 2012 12:31 AM
Thomas Carlyle and Edward Bulwer-Lytton - Giants of the North.htm HTML File 50.6 KB Oct 2 2012 12:27 AM
Thomas Jefferson - Letter to the Secretary of the Treasury Albert Gallatin.txt Text File 756 Bytes Oct 2 2012 12:33 AM
Thomas W. Chittum - Civil War II.pdf PDF Document 2.3 MB Oct 2 2012 12:28 AM
thousandsattendvoodoofestival.html HTML File 4 KB Oct 2 2012 12:33 AM
Thousands Protest Violence in Darfur.htm HTML File 3.4 KB Oct 2 2012 12:33 AM
Threats to a Free Internet.htm HTML File 17.2 KB Oct 2 2012 12:27 AM
ThunderDome.htm HTML File 3.5 KB Oct 2 2012 12:33 AM
ThusSpakeZarathustra.pdf PDF Document 917.3 KB Oct 2 2012 12:33 AM
tiffany_long.pdf PDF Document 497.5 KB Oct 2 2012 12:33 AM
tilak-pdf.zip ZIP Archive 1.6 MB Oct 2 2012 12:30 AM
Tiny Differences, Through Time, are Everything.htm HTML File 30.2 KB Oct 2 2012 12:31 AM
tipsforthewrittenexamination.pdf PDF Document 170.4 KB Oct 2 2012 12:30 AM
tob_shebbe_goyim_harog_first6.pdf PDF Document 757.5 KB Oct 2 2012 12:31 AM
Today Show - Let 'Em Eat Cake.htm HTML File 2.7 KB Oct 2 2012 12:33 AM
Tolerance.pdf PDF Document 177.3 KB Oct 2 2012 12:33 AM
Tolerance.zip ZIP Archive 76.6 KB Oct 2 2012 12:31 AM
Tom Quick (1851) JR.pdf PDF Document 459.2 KB Oct 2 2012 12:28 AM
Tonight - Current Issues TV to Host Dr. David Duke.htm HTML File 3.6 KB Oct 2 2012 12:34 AM
Toni Morrison - She Simply Can't Write.htm HTML File 4.6 KB Oct 2 2012 12:33 AM
Tookie's 'Peaceful' Pals Threaten Violence.htm HTML File 3 KB Oct 2 2012 12:30 AM
Tookie Advocate - 'That’s a racist question!'.htm HTML File 3.4 KB Oct 2 2012 12:31 AM
Tookie Finally Ready to Snitch.htm HTML File 4.3 KB Oct 2 2012 12:34 AM
Too White, Too Strong.htm HTML File 9.2 KB Oct 2 2012 12:28 AM
too_white.pdf PDF Document 455.6 KB Oct 2 2012 12:33 AM
too_white_sm.pdf PDF Document 459.6 KB Oct 2 2012 12:33 AM
Top Rabbi - Katrina is God's Punishment for Not Supporting Israel.htm HTML File 2.7 KB Oct 2 2012 12:29 AM
tor2005-224.pdf PDF Document 188.7 KB Oct 2 2012 12:34 AM
Toronto Rampage Flyer.pdf PDF Document 51.3 KB Oct 2 2012 12:29 AM
Tourists Evacuated from Superdome.htm HTML File 3 KB Oct 2 2012 12:30 AM
Tourists Targeted in New Orleans as Unrest Spreads to Baton Rouge.htm HTML File 4.2 KB Oct 2 2012 12:33 AM
traffic.pdf PDF Document 418.6 KB Oct 2 2012 12:28 AM
Troops Back From Iraq Find Another War Zone.htm HTML File 13.9 KB Oct 2 2012 12:28 AM
Troops Find Grisly Scenes in New Orleans Convention Center.htm HTML File 4.9 KB Oct 2 2012 12:33 AM
trr.pdf PDF Document 4.2 MB Oct 2 2012 12:31 AM
trr.zip ZIP Archive 1.4 MB Oct 2 2012 12:32 AM
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast.htm HTML File 145.1 KB Oct 2 2012 12:31 AM
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast2.htm HTML File 143 KB Oct 2 2012 12:27 AM
Turkey, EU Reach Deal for Opening Talks.htm HTML File 3.7 KB Oct 2 2012 12:29 AM
Turkey Has No Friends; Good for Europe.htm HTML File 5.4 KB Oct 2 2012 12:30 AM
Turkey Wins Censorship of Armenian Genocide in German Schools.htm HTML File 3.9 KB Oct 2 2012 12:33 AM
Turkish Novelist Faces Jail for ‘Hate Speech’.htm HTML File 4.9 KB Oct 2 2012 12:33 AM
Turks Award Zionists with Weapons Contract.htm HTML File 2.3 KB Oct 2 2012 12:34 AM
Turks Convict Armenian Journalist of 'Speech Crime'.htm HTML File 3.9 KB Oct 2 2012 12:30 AM
Turks May Save Drowning Rat.htm HTML File 3.5 KB Oct 2 2012 12:28 AM
TurnerDiaries.pdf PDF Document 809.7 KB Oct 2 2012 12:32 AM
TurnerDiaries.rtf RTF File 1.9 MB Oct 2 2012 12:31 AM
turnerdiaries.zip ZIP Archive 279 KB Oct 2 2012 12:34 AM
turn_it_down_resource_kit.pdf PDF Document 507.9 KB Oct 2 2012 12:28 AM
Two More 'Sexual Indoctrination' Bills Vetoed.htm HTML File 3 KB Oct 2 2012 12:27 AM
TWPL_Final.pdf PDF Document 3 MB Oct 2 2012 12:33 AM
U.S. Population Nears 300 Million.htm HTML File 5.4 KB Oct 2 2012 12:31 AM
U.S.S. Liberty,.html HTML File 56.9 KB Oct 2 2012 12:33 AM
U.S.S. Liberty Crew Reunites.htm HTML File 3.8 KB Oct 2 2012 12:33 AM
U.S. State Department - Israel Plagued by Trafficking.htm HTML File 3.3 KB Oct 2 2012 12:31 AM
Ugly Lessons from Katrina.htm HTML File 3.7 KB Oct 2 2012 12:28 AM
UK - Al Qaeda 'Cleric' Worked for Both Sides.htm HTML File 4.4 KB Oct 2 2012 12:32 AM
UK - Birmingham Riots Result of Multicultural Experiment.htm HTML File 3.3 KB Oct 2 2012 12:32 AM
UK - Black Gets Prison for al-Qaeda Plot.htm HTML File 2.8 KB Oct 2 2012 12:33 AM
UK - BNP Music Label Launched.htm HTML File 4.2 KB Oct 2 2012 12:28 AM
UK - BNP Picking Up Votes - Viewed as Persecuted Underdog.htm HTML File 5 KB Oct 2 2012 12:32 AM
UK - British National Party Chairman Nick Griffin Released.htm HTML File 7.1 KB Oct 2 2012 12:29 AM
UK - Censorship by Multiracialists Raises Ugly Head.htm HTML File 4.6 KB Oct 2 2012 12:32 AM
UK - Conservatives Fear Nationalist Competition.htm HTML File 7.5 KB Oct 2 2012 12:31 AM
UK - English Town Continues to Suffer From Multiracialism.htm HTML File 3.1 KB Oct 2 2012 12:31 AM
UK - Jews Condemned for Throat-Cutting Ritual.htm HTML File 1.7 KB Oct 2 2012 12:31 AM
UK - Keighley Protest Still On.htm HTML File 3.9 KB Oct 2 2012 12:29 AM
UK - Muslims Scream About Ice Cream.htm HTML File 4.7 KB Oct 2 2012 12:31 AM
UK - National Demonstration Against Police Anti-White Racism Planned.htm HTML File 7.6 KB Oct 2 2012 12:28 AM
UK - Nov. 2 Free Speech Demo Plan Forges Ahead.htm HTML File 4.1 KB Oct 2 2012 12:28 AM
UK - Now It's Griffin.htm HTML File 12.3 KB Oct 2 2012 12:31 AM
UK - Police Arrest Anti-White Goon.htm HTML File 4 KB Oct 2 2012 12:33 AM
UK - Police Investigating Multiracialist Entertainer for Threatening Whites.htm HTML File 3.2 KB Oct 2 2012 12:27 AM
UK - Popular Muslim Video Supports Violence Against Non-Believers.htm HTML File 4.3 KB Oct 2 2012 12:33 AM
UK - Race Rioting Erupts in Birmingham.htm HTML File 13.5 KB Oct 2 2012 12:31 AM
UK - Racial Justice Sunday Staged by Rapidly Shrinking Church.htm HTML File 7.8 KB Oct 2 2012 12:31 AM
UK - Secret Police Seize Nationalist Paper.htm HTML File 10.6 KB Oct 2 2012 12:30 AM
UK - Top Cop Urges Police To Wear Islamic Battle Colors.htm HTML File 7.2 KB Oct 2 2012 12:30 AM
UK - White Leaders Undaunted by Coordinated Violent Attacks.htm HTML File 4 KB Oct 2 2012 12:30 AM
UK - Whites Furious Over Removal of Memorial To Slain Teenager.htm HTML File 3.4 KB Oct 2 2012 12:28 AM
UK - Whites Quitting Cities.htm HTML File 3.5 KB Oct 2 2012 12:33 AM
UK = Church Anger at Islamic Texts.htm HTML File 4.4 KB Oct 2 2012 12:33 AM
UK Cops Threaten Vet Over Flag.htm HTML File 9.7 KB Oct 2 2012 12:31 AM
UK journalist arrested in Israel.htm HTML File 5.1 KB Oct 2 2012 12:33 AM
Ukraine - David Duke Earns Doctorate in History.htm HTML File 12.5 KB Oct 2 2012 12:33 AM
Ulster - Anti-White Loyalist Thug Slain.htm HTML File 7.4 KB Oct 2 2012 12:32 AM
Ulster - Loyalists Join Jews in Human Smuggling Ring.htm HTML File 5.7 KB Oct 2 2012 12:27 AM
Ulster - Religious Fanatics Say No To Catholics, Yes To Non-Whites.htm HTML File 3.8 KB Oct 2 2012 12:27 AM
Ulster-Scots Culture Enjoys a Renaissance.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
ulysses.pdf PDF Document 1 MB Oct 2 2012 12:30 AM
ulysses.rtf RTF File 3.9 MB Oct 2 2012 12:30 AM
UMBCTeenDrivingStudy.pdf PDF Document 473.9 KB Oct 2 2012 12:33 AM
UN Antislavery Day Celebrates Massacre of Whites.htm HTML File 3 KB Oct 2 2012 12:27 AM
UnderstandingJewInfluence.pdf PDF Document 240.2 KB Oct 2 2012 12:33 AM
Underst_White_Priv.pdf PDF Document 1002 KB Oct 2 2012 12:27 AM
UniqueWesternCulture.pdf PDF Document 136.8 KB Oct 2 2012 12:28 AM
Updated - Who Rules America.htm HTML File 50 KB Oct 2 2012 12:30 AM
upperclassblackstudentsunderperforming.html HTML File 7.1 KB Oct 2 2012 12:33 AM
Uprising.pdf PDF Document 2.5 MB Oct 2 2012 12:32 AM
urban guerilla.pdf PDF Document 73.2 KB Oct 2 2012 12:31 AM
US - White Poverty Soars.htm HTML File 2.4 KB Oct 2 2012 12:32 AM
usbegsjewstostopsellingmilitarytechnologytochina.html HTML File 3.4 KB Oct 2 2012 12:32 AM
uscollegetestatcenterofracechargeddebate.html HTML File 5.8 KB Oct 2 2012 12:31 AM
US Condemns 14 Countries for Human Trafficking.htm HTML File 2.1 KB Oct 2 2012 12:33 AM
US Evangelicals Increasingly Question Pro-Zionist Heresy.htm HTML File 2.3 KB Oct 2 2012 12:28 AM
US Iraq Atrocities Nothing New.htm HTML File 4.5 KB Oct 2 2012 12:31 AM
US Left - Tools of Oligarchs, Zionists, System.htm HTML File 4.8 KB Oct 2 2012 12:31 AM
US Nationalists Record Song for BNP.htm HTML File 3.3 KB Oct 2 2012 12:29 AM
US Provided KLA With Food.htm HTML File 2.3 KB Oct 2 2012 12:28 AM
usseekstocurbisraeliarmssalestochina.html HTML File 15.3 KB Oct 2 2012 12:33 AM
USS LIBERTY Memorial - AMERICAN LEADERS SUPPORT USS Liberty SURVIVORS.htm HTML File 84 KB Oct 2 2012 12:28 AM
USS Liberty Veterans Present Pentagon With Report on Israeli War Crimes.htm HTML File 33.2 KB Oct 2 2012 12:31 AM
ustechnologyappearsinnewchinesewarplaneviaisrael.html HTML File 12.4 KB Oct 2 2012 12:27 AM
Usury Perfected.htm HTML File 2.1 KB Oct 2 2012 12:28 AM
Utahns Leaving Multiracial Public Schools.htm HTML File 3.2 KB Oct 2 2012 12:30 AM
V-News.org Exclusive - The Plan De San Diego.htm HTML File 6.3 KB Oct 2 2012 12:31 AM
Vang Guilty in Hunter Massacre Trial.htm HTML File 3.9 KB Oct 2 2012 12:30 AM
Vang Says Three Hunters Deserved to Die.htm HTML File 2.8 KB Oct 2 2012 12:34 AM
Vanguard News Network » Blog Archive » Important Thoughts, Financial and Economic Advice.htm HTML File 115.3 KB Oct 2 2012 12:30 AM
Vanunu - Israel's Nuclear Arsenal a Threat to Middle East.htm HTML File 4.1 KB Oct 2 2012 12:32 AM
vargsmal.zip ZIP Archive 101.3 KB Oct 2 2012 12:33 AM
Venezuelan Chavez wants to be world's anti-U.S. voice.htm HTML File 10.3 KB Oct 2 2012 12:30 AM
Veteran Congressman Paul Findley Exposes Israel’s Lobby.htm HTML File 7.3 KB Oct 2 2012 12:32 AM
vfsky.pdf PDF Document 82.6 KB Oct 2 2012 12:31 AM
VH.zip ZIP Archive 1.9 MB Oct 2 2012 12:31 AM
video.html HTML File 49.8 KB Oct 2 2012 12:32 AM
Vigilantes Attack Elderly Border Protestors.htm HTML File 3.4 KB Oct 2 2012 12:33 AM
Viktor Schauberger.txt Text File 11.1 KB Oct 2 2012 12:33 AM
Viroqua, WI School Board Bans 'Diversity Day'.htm HTML File 6 KB Oct 2 2012 12:31 AM
VirusHouse.pdf PDF Document 2 MB Oct 2 2012 12:31 AM
vnntaa1a.pdf PDF Document 1.3 MB Oct 2 2012 12:33 AM
vnntaa2.pdf PDF Document 1.7 MB Oct 2 2012 12:32 AM
vnntaa3.pdf PDF Document 1.4 MB Oct 2 2012 12:28 AM
Vof64-1.pdf PDF Document 1.6 MB Oct 2 2012 12:31 AM
Vof64-2.pdf PDF Document 629.4 KB Oct 2 2012 12:31 AM
Vof64-3.pdf PDF Document 649.3 KB Oct 2 2012 12:28 AM
Vof64-4.pdf PDF Document 915.2 KB Oct 2 2012 12:31 AM
Vof64-5.pdf PDF Document 344.4 KB Oct 2 2012 12:27 AM
Vof64-6.pdf PDF Document 543.3 KB Oct 2 2012 12:33 AM
Vof64-7.pdf PDF Document 564 KB Oct 2 2012 12:31 AM
Vof64-8.pdf PDF Document 8 MB Oct 2 2012 12:28 AM
Vof64-9.pdf PDF Document 8.6 MB Oct 2 2012 12:34 AM
Vof64-10.pdf PDF Document 655.5 KB Oct 2 2012 12:27 AM
Vof64-11.pdf PDF Document 831.1 KB Oct 2 2012 12:32 AM
Vof64-12.pdf PDF Document 462.8 KB Oct 2 2012 12:28 AM
Vof64-13.pdf PDF Document 1 MB Oct 2 2012 12:33 AM
Vof64-14.pdf PDF Document 1 MB Oct 2 2012 12:33 AM
Vof64-15.pdf PDF Document 2.1 MB Oct 2 2012 12:34 AM
Vof64-16.pdf PDF Document 3.2 MB Oct 2 2012 12:28 AM
Voice For Europe - Pan-European Co-ordination Against Turkish EU Membership.htm HTML File 3.2 KB Oct 2 2012 12:27 AM
Voices from the Past - Languages of Our Ancestors.htm HTML File 3.4 KB Oct 2 2012 12:31 AM
Voodoo Faithful on Annual Pilgrimage.htm HTML File 3.1 KB Oct 2 2012 12:34 AM
Voting for Pro-White Parties Is 'Spitting in God's Face'.htm HTML File 4.8 KB Oct 2 2012 12:33 AM
Wal-Mart Turns in Student’s Anti-Bush Photo, Secret Service Investigates Him.htm HTML File 4 KB Oct 2 2012 12:30 AM
Wales - Win for 'Heretic'.htm HTML File 4.2 KB Oct 2 2012 12:33 AM
WalkerIndictment.pdf PDF Document 149.5 KB Oct 2 2012 12:33 AM
WallStreetCommieRevolution.pdf PDF Document 586.2 KB Oct 2 2012 12:31 AM
WarBetweenGenerals.pdf PDF Document 3.6 MB Oct 2 2012 12:33 AM
War Criminal at Bay.htm HTML File 3.9 KB Oct 2 2012 12:31 AM
WarIsARacket.pdf PDF Document 42.6 KB Oct 2 2012 12:30 AM
War Party Atrocity Porn.htm HTML File 2.9 KB Oct 2 2012 12:30 AM
WarPath.pdf PDF Document 2.4 MB Oct 2 2012 12:31 AM
War Signals.htm HTML File 2.9 KB Oct 2 2012 12:32 AM
WAR_AryanUpdates2003_02_01_00_99.pdf PDF Document 3.4 MB Oct 2 2012 12:31 AM
WAR_AryanUpdates2004_03_02.pdf PDF Document 3.3 MB Oct 2 2012 12:31 AM
Was Columbus Greek.htm HTML File 6 KB Oct 2 2012 12:31 AM
WAS THERE REALLY A HOLOCAUST.htm HTML File 19.7 KB Oct 2 2012 12:28 AM
Was WWII Worth It.htm HTML File 6.7 KB Oct 2 2012 12:29 AM
WATCHING.pdf PDF Document 80.6 KB Oct 2 2012 12:27 AM
Watts Riots 40 Years On.htm HTML File 2.8 KB Oct 2 2012 12:33 AM
wausau.htm HTML File 38.7 KB Oct 2 2012 12:32 AM
WausauImmigration.pdf PDF Document 38.5 KB Oct 2 2012 12:30 AM
WausauImmigration.rtf RTF File 64 KB Oct 2 2012 12:28 AM
WealthOfNations.pdf PDF Document 1.4 MB Oct 2 2012 12:28 AM
We at The Scriptorium.htm HTML File 15.5 KB Oct 2 2012 12:33 AM
weekly report 01.pdf PDF Document 363.3 KB Oct 2 2012 12:31 AM
Welcome, TAA#3 readers - Background on our authors subjects.htm HTML File 71.3 KB Oct 2 2012 12:33 AM
Welcome News - Turks May 'Shun' EU Talks.htm HTML File 3.7 KB Oct 2 2012 12:31 AM
Welcome to the Jungle - Superdome Tales.htm HTML File 3 KB Oct 2 2012 12:31 AM
Wendy Campbell - 2006-09-11 - Parallels between Nazism, Zionists striking.htm HTML File 29.5 KB Oct 2 2012 12:30 AM
We The People.htm HTML File 3.7 KB Oct 2 2012 12:33 AM
What's in the New Orleans Water.htm HTML File 5.5 KB Oct 2 2012 12:29 AM
What's This About 'Peak Oil'.htm HTML File 4.5 KB Oct 2 2012 12:33 AM
What's Your Diversity Quotient.htm HTML File 15.1 KB Oct 2 2012 12:31 AM
What About 'Affirmative Action' for US Media Ownership.htm HTML File 15.4 KB Oct 2 2012 12:28 AM
What Does Israel Want.htm HTML File 2.6 KB Oct 2 2012 12:31 AM
What is National Vanguard - intro.pdf PDF Document 1.4 MB Oct 2 2012 12:32 AM
What is National Vanguard.htm HTML File 22.7 KB Oct 2 2012 12:31 AM
What is So Wrong With White People.htm HTML File 8.2 KB Oct 2 2012 12:31 AM
What Makes Palestinians Think They Can.htm HTML File 7.6 KB Oct 2 2012 12:28 AM
What Makes Western Culture Unique.htm HTML File 4.8 KB Oct 2 2012 12:29 AM
whatsnew.htm HTML File 6.4 KB Oct 2 2012 12:28 AM
WhatTheTalmudTeaches.pdf PDF Document 213 KB Oct 2 2012 12:34 AM
What will become of the ‘American Dream’.htm HTML File 4.9 KB Oct 2 2012 12:31 AM
What Would War Look Like.htm HTML File 5.4 KB Oct 2 2012 12:32 AM
Wheat and Chaff.htm HTML File 4.1 KB Oct 2 2012 12:33 AM
When Al Qaeda Was An Ally of 'the West'.htm HTML File 4.7 KB Oct 2 2012 12:31 AM
When In Our Music God Is Glorified.doc Microsoft Word Document 20.5 KB Oct 2 2012 12:27 AM
where_are_wmd.pdf PDF Document 92 KB Oct 2 2012 12:31 AM
Which Way, Milwaukee.htm HTML File 14.8 KB Oct 2 2012 12:31 AM
WhiteAmerica.pdf PDF Document 527.7 KB Oct 2 2012 12:32 AM
White America starts winning.htm HTML File 7 KB Oct 2 2012 12:31 AM
White Children Experience Slavery at Summer Camp.htm HTML File 3 KB Oct 2 2012 12:30 AM
White Heritage Sites Threatened on Cyprus.htm HTML File 3.8 KB Oct 2 2012 12:33 AM
White India.htm HTML File 4.7 KB Oct 2 2012 12:27 AM
White Interests.htm HTML File 3.1 KB Oct 2 2012 12:33 AM
WhiteMansBibleOrig.pdf PDF Document 1.3 MB Oct 2 2012 12:28 AM
White Nationalist Position Statements.pdf PDF Document 55.7 KB Oct 2 2012 12:27 AM
White Nationalist Position Statements.txt Text File 7 KB Oct 2 2012 12:30 AM
White People's Party Forms in Nevada.htm HTML File 5.4 KB Oct 2 2012 12:34 AM
WhitePower.pdf PDF Document 766.1 KB Oct 2 2012 12:27 AM
whitesblacks100factsandonelie.html HTML File 62.2 KB Oct 2 2012 12:31 AM
White Science, Black Humor.htm HTML File 13.7 KB Oct 2 2012 12:30 AM
WhiteSlaveryBibliography.pdf PDF Document 72.1 KB Oct 2 2012 12:27 AM
White Slavery Focus of New Book.htm HTML File 2.6 KB Oct 2 2012 12:32 AM
Whites Make Stand at Superdome.htm HTML File 3.2 KB Oct 2 2012 12:31 AM
Whites Organize in Namibia.htm HTML File 2.8 KB Oct 2 2012 12:31 AM
Whites Repulse Turks in Georgian Waters.htm HTML File 5.3 KB Oct 2 2012 12:33 AM
Whites Suffering in New Orleans.htm HTML File 3.2 KB Oct 2 2012 12:27 AM
White Teen Dragged from Bus, Beaten, and Robbed by Anti-White Gang Members.htm HTML File 2.3 KB Oct 2 2012 12:31 AM
White Wire Newsblog » A History of Kwanza by Ann Coulter…and a Special Kwanza Jingle From the White Wire Staff.htm HTML File 20.7 KB Oct 2 2012 12:33 AM
Who Brought the Slaves to America -- part II of II.htm HTML File 28.4 KB Oct 2 2012 12:31 AM
Who Brought the Slaves to America -- part I of II.htm HTML File 20.7 KB Oct 2 2012 12:31 AM
Who Rules America.htm HTML File 49.6 KB Oct 2 2012 12:32 AM
WhoRulesAmerica.pdf PDF Document 51.2 KB Oct 2 2012 12:31 AM
Who We Sold the Serbs To.htm HTML File 6.6 KB Oct 2 2012 12:33 AM
WhoWillFeedChina.pdf PDF Document 43.5 KB Oct 2 2012 12:30 AM
whydoblackstudentslagbehind.html HTML File 15.7 KB Oct 2 2012 12:28 AM
Why Hitler Attacked Soviet Russia When He Did.htm HTML File 31.5 KB Oct 2 2012 12:31 AM
whyisafricapoor.html HTML File 19.7 KB Oct 2 2012 12:28 AM
Why Islam Didn't Conquer the World.htm HTML File 6.6 KB Oct 2 2012 12:30 AM
Why Israel’s Campaign in Lebanon is Failing.htm HTML File 8.8 KB Oct 2 2012 12:33 AM
Why Scandinavia Tops U.N. Standard of Living Index.htm HTML File 3.8 KB Oct 2 2012 12:31 AM
why_reverse_evolution.pdf PDF Document 209.4 KB Oct 2 2012 12:33 AM
why_reverse_evolution_color.pdf PDF Document 629.2 KB Oct 2 2012 12:34 AM
WichitaMassacre.pdf PDF Document 520.3 KB Oct 2 2012 12:28 AM
WichitaMassacreHomepage.pdf PDF Document 957.5 KB Oct 2 2012 12:30 AM
wiesenthal - fake holocaust.htm HTML File 15.9 KB Oct 2 2012 12:27 AM
Wife-Beating Drug Addict Demands Custody Of Prussian Blue.txt Text File 2.2 KB Oct 2 2012 12:30 AM
Wife19.pdf PDF Document 8.1 MB Oct 2 2012 12:33 AM
WinterSonnenWend.pdf PDF Document 1.5 MB Oct 2 2012 12:31 AM
wiretap.pdf PDF Document 453.6 KB Oct 2 2012 12:29 AM
Wisconsin - New Flood of Hmong Refugees Will Strain Already Tight Budgets.htm HTML File 5.7 KB Oct 2 2012 12:33 AM
Wisconsin - Rampage Killer, Friends Now Suspects in 2001 Homicide.htm HTML File 7.1 KB Oct 2 2012 12:27 AM
Wisconsin Loves Its Non-Whites Too.htm HTML File 5.8 KB Oct 2 2012 12:31 AM
Witnesses - New Orleans Cops are Looters.htm HTML File 3.2 KB Oct 2 2012 12:28 AM
WKRC_UAS.wmv WMV File 5.8 MB Oct 2 2012 12:28 AM
wmb.pdf PDF Document 1.3 MB Oct 2 2012 12:31 AM
wn-urls.txt Text File 4.7 KB Oct 2 2012 12:33 AM
wood103.pdf PDF Document 196.8 KB Oct 2 2012 12:31 AM
Worldwide Lack of Concern Over Israel's White Slave Trade.htm HTML File 4.5 KB Oct 2 2012 12:33 AM
WPP Guidelines.pdf PDF Document 21.3 KB Oct 2 2012 12:33 AM
WPP Petition.pdf PDF Document 723.2 KB Oct 2 2012 12:27 AM
WPP Platform.pdf PDF Document 57.5 KB Oct 2 2012 12:31 AM
wra.pdf PDF Document 289.2 KB Oct 2 2012 12:31 AM
wra2004.pdf PDF Document 899.9 KB Oct 2 2012 12:32 AM
wraflyer.pdf PDF Document 45.4 KB Oct 2 2012 12:32 AM
WSCwrote1920.html HTML File 11.1 KB Oct 2 2012 12:33 AM
wtc1.pdf PDF Document 5.3 MB Oct 2 2012 12:31 AM
WTC 911 plot.pdf PDF Document 334.7 KB Oct 2 2012 12:31 AM
WTC_1page.pdf PDF Document 5.3 MB Oct 2 2012 12:33 AM
wvr.pdf PDF Document 13.2 MB Oct 2 2012 12:34 AM
yellow.pdf PDF Document 1 MB Oct 2 2012 12:33 AM
YGGDRASIL - Lesson Number One.htm HTML File 21.4 KB Oct 2 2012 12:27 AM
YggdrasilsLibrary.pdf PDF Document 3.1 MB Oct 2 2012 12:30 AM
YggLibraryFull.pdf PDF Document 4.3 MB Oct 2 2012 12:31 AM
youre_fired.pdf PDF Document 1.3 MB Oct 2 2012 12:28 AM
Youth Gang Rape Reported in Milwaukee.htm HTML File 6.5 KB Oct 2 2012 12:28 AM
Zimbabwe - Armed Police Stealing Farm Equipment.htm HTML File 3.9 KB Oct 2 2012 12:28 AM
Zimbabwe - Monkey Behind Famine.htm HTML File 3.2 KB Oct 2 2012 12:31 AM
ZionismInAgeOfDictators.pdf PDF Document 1.3 MB Oct 2 2012 12:28 AM
ZionistAntiSemitism.pdf PDF Document 32.7 KB Oct 2 2012 12:28 AM
zionistcoverup.pdf PDF Document 1.4 MB Oct 2 2012 12:33 AM
zionistcoverup.rtf RTF File 1 MB Oct 2 2012 12:31 AM
Zionists Cheer Creep DeLay.htm HTML File 3.7 KB Oct 2 2012 12:28 AM
Zionist Shill's Mistake Endangers Family.htm HTML File 3.9 KB Oct 2 2012 12:28 AM
Zionists Show Contempt For Christians.htm HTML File 3.4 KB Oct 2 2012 12:28 AM
Zionists Slam Greeks.htm HTML File 3.9 KB Oct 2 2012 12:30 AM
Zionists Threaten Leader with Occult Ritual Murder.htm HTML File 8 KB Oct 2 2012 12:28 AM
Zionist Televangelist Paid Hush Money in 'Gay' Scandal.htm HTML File 4.1 KB Oct 2 2012 12:30 AM
Zionist Thug Invaders Stir Plate of Violence for Passover Celebrations, Celebrate the Cruel Killing of Innocent Egyptian Children 3,000 Years Ago..html HTML File 14.4 KB Oct 2 2012 12:31 AM
zogencryption.htm HTML File 21.4 KB Oct 2 2012 12:27 AM
ZweitesBuch.pdf PDF Document 324.9 KB Oct 2 2012 12:32 AM
ZyklonAd-War.pdf PDF Document 313 KB Oct 2 2012 12:33 AM
‘Patriotism’ is the Last Refuge of the Scoundrel.htm HTML File 4.9 KB Oct 2 2012 12:32 AM
The preterhuman.net network is powered by Altexxa Group. Our partners include CupidClick Dating, Canhost, OMGWTFBBQ.