../ | | | |
'Affirmative Action' Chief Latest 'Victim' of Katrina_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Anti-Semitism' Center Set Up at Yale_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Border Baby' Boom Strains South Texas_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Down Low' Lifestyle Causing AIDS Epidemic Among Blacks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Down Low' Lifestyle Suspected in Porn Industry HIV Scare_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Gay' Groups Fight Parents Over School's Mandatory Homosexual Indoctrination_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Governator' Refuses Tookie Clemency_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'IQ' vs. Standardized Tests_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'I Was a Victim of Racial Violence in Junior High'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Madonna' - Diva of Degeneracy to Perform in Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Mighty Whitey' Defends Algiers Point_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Mud Duck' - Vang Trial Hits Emotional Peak_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Neutral' Official to KLA - 'Careful With Those Grenades'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Sugar daddies' fuelling HIV spread_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Tolerance' Runs Out for Firm_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Voices of Heaven' Ordered Not to Sing Sacred Music_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
2 standards for diversity in the legal fraternity_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
9-11 Families Demand Action on Immigration_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
15,000 Hmong Head for Minnesota_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
50 Cent Gives New Meaning to 'Da Bomb'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
100 Million Dead - JEWS AND COMMUNISM Part 1_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
100 Million Dead - JEWS AND COMMUNISM Part 2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
100 Million Dead - JEWS AND COMMUNISM Part 3_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
260 million CHRISTIAN Lives Lost_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
2005-12-07 - Wanted - More Race Realism, Less Moralistic_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
2005-12-07 - wanted_more_race_realism_less.php_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Abandoned and Betrayed_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Abandoned Gold Standard Guarantees Inflation_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ABC Targets White Children_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Accused Negro Sniper to 'Question' His White Victim_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ACLU Top Heavy with Jews_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Date with Bevin_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ADL's Foxman - New Testament is Anti-Semitic_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ADL Anti-Defamation League of B'nai B'rith conducts smear campaigns - ADL Anti-Defamation League of B'nai B'rith is caught in cover-up of its crimes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ADL Briefs U.S. House on Internet 'Hate'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ADL Demands Gulag for Dissenters_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ADL Führer Warns of 'Intermarriage' and Public Schooling_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ADL Opponents Officially Designated As 'Terrorist Organizations'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Adorno's Bastards and the Frankfurt School_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ads Declare Population Driven Environmental Crisis In California_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Advice on building an electric car for those interested_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Africa In Our Midst - Lessons From Katrina_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
African 'Culture' Spreads HIV_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
After Millennia in India, Lost Tribe Returns to Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Agitprop_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Great Day in L.A._files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Group of Friends - Magnet For A Lonely America_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
AIDS Alert! Avoid Sugar Daddies!_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
AIDS Epidemic Among Black Elite_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
AIPAC Congratulates Itself on the Slaughter in Lebanon_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
AIPAC Espionage Case Dismissal Gambit Fails_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
AIPAC Scandal Breaks Loose_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
AIPAC Warns Dems Not to Appear at Anti-war Demo_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Alabama - Immigrants Make School Rolls Larger than Town_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Alan Stang - 2004-01-16 - 'Martin Luther' King - Communist Fraud_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ali G Worries ADL_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Alleged Racial-Beating Victim Admits Concocting Story_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Look Back at Revisionism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Alpin MacLaren - 2006-01-06 - Cold Turkey - Multiracialism is destroying our schools_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Alpin MacLaren - 2006-02-09 - Civil Wrongs_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Alpin MacLaren - 2006-03-02 - When Logic Fails_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Man Named Arkan_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
America's Middle Class Shrinking in Globalist Economy_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
America's Most Powerful Hate Group_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
America Disappearing_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
America Firster Jew Exposes Israel and the Zionist Network_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Americans Say Enough is Enough! Miller Beer Boycott Update_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Amid Katrina Chaos, Congressman Used National Guard to Visit Home_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Mile Too Far_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Minuteman Boosts Border Overhaul Reform_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Anarcho-Tyranny—Where Multiculturalism Leads_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A National Emergency_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Andrew Young Pulls a 'Mel Gibson'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A New Commission for a New Era_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Anti-Child-Molester Protest Stopped by 'Anti-Fascist Action'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Anti-White Discrimination Plagues European Art Scene_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Once Great Britain_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Apartheid State of Israel Expands Colonization of Golan Heights_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
AP In Hurricane 'Moral Equivalency' Hassle_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
AP Interviews Geert Wilders_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Apocalypse at Dresden - The Worst Massacre in the History of the World_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Apparent Drug Overdose Claims Life of National Vanguard Foe_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A review of La convergence des catastrophes by Guillaume Corvus_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Arm Against 'Katricians,' Gun Dealers Tell Houston_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Artful Anecdotes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Asians Murder British Lad for Being White_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A Split In the Racist Right_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Assassination Attempt on David Duke_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Assault Arrest Followed Word to Cheney_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A theory of Einstein the irrational plagiarist_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
August 23, 1917 - Black Mutiny Leaves 16 Whites Dead_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Australia - Rape Gangs and Multiracialism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Austrian court confirms British historian guilty of Holocaust denial_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Austrians Fed Up With Kosher Arnie_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Autumnal Equinox Comes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A V-Reader Gives Belgians a Message_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Avoid Mestizos - AIDS Rampant Among Mestizos_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A White Future is Coming - an interview with Bob Whitaker_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
A White Majority For New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Axe Wielding Albanian Mob Brutally Assaults Elderly Serb Couple in Kosovo_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Aztecs Butchered, Ate Prisoners_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Background on the Jewish Defense Organization_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Back to...Homeschool_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ban-Crazy Brits Nix St. George Again_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Baton Rouge Whites Mob Gun Stores_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
BBC To Report On London Kabbalah Center_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Beauty, Art, and Race_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Behind the Mask of Respectability - The truth about the Anti-Defamation League of B'nai B'rith_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Belgian Police Raid Revisionists_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Belgium - Multicultural Fascism Now Official Policy_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Beloved Wagnerian Soprano Passes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Benedict Meets with Dissident Journalist_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Benedict to Meet with Traditionalists_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Bergen's Lie_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Between the Jews and the Gentiles -- In the Aggadah, the Kabbalah, and in Jewish Thought_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Beyonce - 'I Make Black Records'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Beyond Chutzpah_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Birmingham Riots - Color is Only Skin Deep_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black 'Jews' Accused in Israeli Welfare Scam_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black Ex-Crack Salesman to Launch 'Books'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black God Begs Devil for Dignified Demise_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black HUD Chief Foresees a 'Whiter' New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black Leaders and the Demise of the OIC_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black Muslim Update - Oakland Store Arab Kidnapped_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Blackness Tells It Like It Be_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black Panther Foundation Seeks to Sell 'Burn Baby Burn' Hot Sauce_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black Panthers Jailed in Cop-Killing Probe_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black Refugee Accused of Raping Retarded Girl_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Blacks on New Orleans Looting Rampage_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black US Employees Accused of Slave-driving in Africa_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Black Vikings Fumble 'Ethics'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Blood on the Frost - Never Forget the Hmong Massacre_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
BNP Gets Voice on Yorkshire Race Council_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
BNP Leader Affirms - Islam 'Wicked' Faith_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Bombs and Hurricanes - Our Struggle_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
books-immigration_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Boycott Miller for Supporting Illegal Aliens and Illegal Immigration_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Brigham Young's Speech on Slavery, blacks and the Priesthood_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Britain Recruited Muslim Terrorists_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Britain’s Racial Diversity Brings Murder; No Justice_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Britons Pay Price for Neo-Con Madness_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Briton tells of Katrina nightmare_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Brooklyn-Based Jew Admits to Trafficking in Women_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Brooklyn - Black 'Students' Charged With Anti-White Race Attack_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Brooklyn Jew Ritually Murders Chickens_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Bush - It's All About the Spin_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Bush Buddy in Flap over Jewish 'Holy Water'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Bush Speech Gave Race Hustlers Fresh Ammo_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
By way of deception thou shalt do war_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
By Way Of Deception_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
California - April Gaede Awarded Queen Isabella Prize_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
California - Minuteman Won Election Day Vote_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
California - Pro-White Music At Folk The System_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
California - Tookie's Son on the Run_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
California - Tookie Executed_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
California Initiative for State Border Police Gaining Ground_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Can 'Liberals' Be Educated_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Cannibalism in the African Congo_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Cans of Paint, Two White Halves, and Chromosomes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Challenging the Power of the Jewish Lobby - What Should Be Done_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Challenging the Power of the Jewish Lobby_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Chavez Condemned for 'Anti-Semitism'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Cherishing an Older Catholicism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Chertoff Aide Guilty in Child Porn Case_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Chertoff Claims He Didn't Have A Clue_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Chertoff Proposes Non-Profit Spying Group_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Chertoff Timeline_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Children - National Treasure or Personal Luxury Item_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
China, Deflation And The Dollar_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
China Replaces U.S. As World's Largest Exporter_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Chosen for Pornography_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Christian Colleges Offer Free Tuition to Katrina Refugees_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Christians in Jerusalem Want Jews to Stop Spitting on Them_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Church asks evacuee to leave_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Church fighting IRS over anti-war sermon won't give up documents_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Churchill's War/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Chutzpah - Zionists Running Anti-Slavery Organization_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Civil War in Europe_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Colorado - 57 Refugees Have Felony Records_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
CompleteGuide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Confirmed - Snipers Black_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Congressional Black Caucus Holds Press Conference_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Congressman Apologizes, Denies Assaulting Mistress_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Contemporary Trotskyism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Controlled Media - Forget the Facts About Katrina_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Corrupting Our Police_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Court Temporarily OKs Domestic Spying_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Court to Tookie - No Thanks, Snitch_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Creationism and Truth_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Crime Cover-Up in DC_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Criticism is Not Hate_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Curt Maynard - 2006-07-02 - A Frank Discussion of Jewish Group Dynamics_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Czech Gets Expensive Lesson_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dallas Cops Nix Katrina Officers_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dan Osterton - 2006-07-20 - The Necessity of Invasion_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Daryl Bradford Smith - Prepare for the upcoming battle_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
David Daugherty - 2006-02-09 - Thanks, We Have Our Own Media Now_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
David Irving the 'Anti-Semite'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
David Lane - Dissension in the Ranks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
David_Lane - The Final Address of David Lane to the Jury_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dealing With the Peak Oil Critics_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Death Gate Cycle/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Debating the Lobby_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Deejay - 'I'm Coming for Your Seed'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Deejay’s Appeal - ‘Kill the Whiteness Inside’_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Defense Firms Making a Killing on Iraq War_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Defensible Racism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Democrats Condemn Chertoff's Incompetence_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Denver National Vanguard - Supporting the Columbus Day Parade_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Desperate Jewish News Outlets Abandoning Last Pretenses of Honesty_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Devil's Advocate - The Chinese Have Guts_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Did Arabs Accidentally Get Canned Pork By Mistake_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Did Time Magazine Lie to Pad Circulation_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Disaster Buck Stopped at Chertoff, Not Brown_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Discussing Race in a Globalized World_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Diversity Can Only Be Countered With Brutality And War_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dividing the World_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Do Blacks Deserve Billions for Slavery_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Do They Think It’s Worth It_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Do Whites Really Deserve to Exist_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dr. Lorraine Day’s Response to Judy Andreas - zionism -_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
DR Congo's atrocious secret_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dreaming of a Black Christmas_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dream of inter-racial cooperation finally a UK reality_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Drug Feud Claims Life of Anti-White Activist_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dumbing Down America_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dutch Inquisition Reborn_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Dutch to Become First European Nation to Ban Burka_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ebonics Suggested for District_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Editing Martin Luther King, Jr_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Educational Sabotage_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Educators Baffled at Stubborn Achievement Gap_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Edward Fagan Sues Lloyd's of London, U.S. Government_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
einstein-prioritymyth_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
EinsteinStoleE=mc2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Eire - YOU DID IT! Now Let's Build On the Success_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Elizabeth Smith - A Woman Looks at the Lifetime Channel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Empowerment by Rape - the Sexual Holocaust_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ending the Dollar's Tyranny_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
End of an Era - Spearhead to Close_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
End of the Rainbow_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
England Prepares to Honor Millenium of First Patron Saint_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
English Lad 'Too Pale'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Englishman's Zimbabwean Road Trip to Texas_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Enron - A Microcosm of America_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ethiopian Government Begs After Bumper Crop_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Euro 2005 DVD_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
European Origins of Halloween_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Europeans Having Second Thoughts about Turkey_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
European Union Applies 'Hate Speech' Rules to Internet_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Europe’s Successful Moon Probe Mission_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Euro Slurs and Hate Caricatures_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ex-IRA Soldier Condemns Loss of Traditional Ireland_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ex-Security Chief Blows Whistle on UN's Kosovo Mission_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Exercise, It’s Not What Your Doctor Prescribed_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Facts To Consider Concerning The Holocaust_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Fading Illusions - D-Day and Reagan_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Fagan Files $1 Billion 'Holocaust Compensation' Lawsuit_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Failures of Our Age - Capitalism and Communism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Famous people with Scotch Irish blood_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Farewell to a Good European_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Fast Times at Regnef High - crying-wolf_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Fear and Illusion_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Feds Say Katrina Refugee Gangs a Threat_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Fewer Than 50,000 Whites in Zimbabwe_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Fighting Organized Crime_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Final Verdict - The false connection between Tim McVeigh and The Turner Diaries_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Finkelstein Debates Israeli Pol_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Five Myths That Sanction Israel's War Crimes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Florida - 'King Tut' Prompts Black Protests_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Florida - Homeowners Association Says 'No' to Evacuees_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Florida - Vote Ubele_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Florida School Board Rejects Hall's Resignation_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Foreword to the new edition - Zundel's Story_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Forgotten Realms/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Former Reps. Earl Hilliard (D-Ala.) and Cynthia McKinney (D-Ga.) - Bad for Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
France - Chirac Calls for Police State to Enforce Multiracialism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
France - Teacher in Hiding_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
France - Turks Must Admit Genocide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
France Lays Dauphin to Rest_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Frank Roman - 2006-10-07 - Impeach The System_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Free Pro-European Music_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Free Speech Can Be Fatal_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Friends of Ulster - USA Scotch Irish _ Ulster Scots_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Front National MP Suspended from Teaching Position for Calling for Open Debate_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Full Text of Ahmadinejad's Letter to Merkel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Genes Trace the Ancient Wanderings of White People_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Genetic Branching - Keep it Going_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
German Politicians Talk Turkey_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Germany - PC Gift to Patriots_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
God, Religion, and Tribal Conflict_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
good_jewbad_jew_paradigm - The Mindset that Impedes Civilization's Healing Process_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Governor Schwarzenegger's Statement Denying Tookie Clemency_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Guilt March Hosts Named For Plagiarist_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Guts - A White Man Who Won't Back Down_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Guy Ritchie - Kabbalah Ruined My Film_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Half of Katrina Refugees Are Criminals_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hans Christian Andersen (1845) - Holger Danske_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Happy German-American Day_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Has King Tut Been 'Whitewashed'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Head of Homeland Security Has Ties With Suspected Financier of 911_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Heather Mac Donald on Immigration on National Review Online - A Latin conservative tidal wave is not coming_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Henry Ford - 1922-01-07 - Candid Address to Jews on the Jewish Problem_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Henry Kissinger - The Walking, Talking Conflict of Interest_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
hey're Not All Bad...Are They_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hezbollah Broke Israeli Codes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
High Druid of Shannara/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
High School Failure Rate Highest in Non-White Districts_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hilarious PC Language Lesson_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Historical Myth Justifies Golan Heights Occupation_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Historical Revisionism – International and Independent Scientific Historical Research/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
H Millard - Homeless Jack on Iran, Freedom, Intellectuals, and the Holocaust_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hmong Immigrant Commits Mass Murder in Northern Wisconsin_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hockney's Secret Knowledge - Refuted_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Holger Dansk - Denmark's Mountain King_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hollywood Slanders Italian Americans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Holocaust Fraud_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Holocaust Hoax to be Hammered at Upcoming Conference in Iran_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Holocaust Lawyer Faces $3.2 Million Malpractice Judgment_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Homeland Security's Casualties_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Homeland Security Nominee Chertoff Aided 9-11 Terror Suspect_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Homeless Jack Offers a Primer_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Homeless Jack on New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Home on the Range_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Homosexual Groups Trying to Distance Themselves From Foley_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Honoring Robert E. Lee_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Houston - Turf War Breaks Out between Katrina Refugees, Locals_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
How Many More Nations Will Israel Attack_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
How Many Tanks Did Israel Lose_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
How Muslims Deal With Third World Immigrants_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
How New Orleans Was Lost_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
How Small Genetic Differences Give Racial Divergency_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
How Unskilled Immigrants Hurt Our Economy_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hugo Chavez - Rise Up Against the Empire_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hurricane Katrina - Blacks Worsen Disaster_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hurricane Katrina and Black Behavior_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hurricane Katrina Devastates Duke Headquarters_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Hushed-up Israeli Spy Operations against USA and Mexico 2000 - 2003_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
If You Tolerate This..._files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Igniting the Spark - An Interview With David Duke_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Illegal Immigration - War with Mexico Approaches_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Illegal Immigration and the Racism of 'Antiracism'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Illegal Immigration Sparks Race War in Cities, Prisions_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Illegals Demand the 'Right' to Break the Law_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Illinois Cops - Arabs Beat, Gas Black_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Indian Schools, Genes, Assimilation, and Illegal Aliens_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Indians Reject Black Claims_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Indicted - Republican Corporate Whore DeLay Resigns_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
In Italy, Al Qaeda Turns to Organized Crime for Protection_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
In Praise of Saudi Arabia_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Institute for Political & International Studies_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Interracial Rape Victim - Called by God to 'Minister Against Racism'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Interview with the Grim Reaper - StantonReaper0905_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Introducing the Global I.D. Card_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Iran - The 'Holocaust' Threat to World Peace_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Iranians Produce Holocaust Cartoons_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Iraq - Christians Leery of Islamic 'Tolerance'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Iraq at the Gates of Hell_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Iraqi Resister - Black Soldiers are Targets_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Irish Academics Urge Israel Boycott_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Irreconcilable Differences_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Is any of this stuff made in Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Is Europe Unable to Assimilate Its Growing Islamic Minority_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Islamic Headscarf Ban Debate Hits Australia_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Islamic Wisdom - 'Rapist' Jailed, 'Victim' Executed_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Islamists Throng in Europe's Powder Keg_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Islam versus Christianity – A reply to The Pope!_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Is Neocon Spokesman Soliciting Murder of David Duke_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel's Interior Minister - 'Stop Spitting on Christians'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel's Sex-Slave Industry Soars_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel - Beyond Good and Evil_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel - New Party Urges Expulsion of Non-Jews_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel - Poll Shows 64 Percent of Israeli Jews Favor Ethnic Cleansing_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel - Was BBC's Peter Hounam Arrested as Punishment_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel Honors Jewish Terrorists Who Attacked America_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli-Sponsored Educational Program for NY Schools_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli Gangster Shot Dead in Russia_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli Minister Calls for Nasrallah's Death_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel in Hot Water Over New Zealand Spies_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli Nuclear Whistleblower Vanunu Speaks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli PM's party plagiarizes from Texas Democrats_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
IsraeliPrimeMinisterDeclaresJewWarOnIranAndSyria_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israelis Among the Holocaust Deniers_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli Sexpionage - The McGreevey, Condit and Clinton Affairs_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israelis Launch Voting Guide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli Sniper Assassinates Two Children_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli Spying - The Mother of All Scandals_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israelis Win Contract To Secure US Borders_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli troops seize million dollars in bank raids across West Bank_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israeli Website Exposes Jewish Extremism!_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel Loan Program Limited to Jews_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel Lobby Denial_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel Pushing U.S. to Bomb Iran_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Israel Wants IAEA to Ignore its Nuclear Arsenal, Concentrate on Iran_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Is There Some Bravery Left in Braveheart_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
It's 1984 in Massachusetts – And Big Brother Is Gay_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
It's Coming to America, Too_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
It's the Genes, Stupid!_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
I Was Israel’s Dupe_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jagger Rejects Kabbalah after Extortion Attempt_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
James and Cindy; Progress and Hope_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Janis Ian - 2002-09-16 - THE INTERNET DEBACLE – AN ALTERNATIVE VIEW_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
JB Cash - 2006-01-05 - Death of a Hero_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
J Dub Gettin’ Funky in Durham_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jeff A. Taylor - 2006-07-24 - Rah-Rah IDF_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jerry Falwell Now Supports 'Gay' Rights_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
jew-occupiedgovernments-USSR-moreevidence - Historical Sources_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
jew-organizations-JDL-Zionist-Terror-Network-IHR_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish 'Muslim' Threatens West with Genocide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Academic Blasts Middle-class Whites for Not 'Integrating' Kids_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Anti-Gentile Hatred in Porn Industry_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Censors Seek to Ban Dissident White Historian_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Genetic Diseases 2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Genetic Diseases_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Lawyer Edward Fagan to Sue African Marxists_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Leader Calls On Zionists To Kill All Palestinian Males_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Mafia Expands White Slave Trade to London_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Porn King May Have Skipped to Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish rabbi calls for extermination of all Palestinian males_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Support for Open Borders - Is it Biological_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Supremacist Michael Chertoff Named Head of Homeland Security_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Supremacists Shaping Election of UN Secretary General_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Terrorist Gets Prison_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Usury and Finance Capital_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Voters Object to New Polling Place2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish Voters Object to New Polling Place_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jewish WMD Whistleblower Vanunu Released But Not Free_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jews - A Religious Community, a People, or a Race_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
jews beat Santa Clause_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jews Relentless In Pursuit of Internet Censorship_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jew Threatens LA With New 9-11_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
JewWatch/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jingle Jam Chaos Closes Minnesota Mall_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
John Barleycorn_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution, continued_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
John H. Campbell - The Moral Imperative of Our Future Evolution_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
John Tyndall - An Anagogical View of Empire_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Journalist Held In Dungeon Of Filth_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Judea declares war on Germany_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Judeo-Fascism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Jury Selection to Be Moved in Bloodbath Trial_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kaballah Crazy!_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kabbalah Red String Market Threatened_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kathleen Christiso - 2006-09-12 - The Coming Collapse of Zionism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina, Iraq, and the Know-It-All Syndrome_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina - Neo-con Pals Rake in the Dough_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina and the Black Tsunami_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Black Tells Fox You Owe Him_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Evacuee Charged with Child Murder_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Evacuees Binge on Cape Cod_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Students Spark Constitutional Debate_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Tensions - School Official Resigns over Remarks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Threatens Croatian-American Tradition_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Threatens to Swamp Utah_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Unleashes HIV+ Horde_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Katrina Victims Unwelcome in Some Towns_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kenya - Black Priest Kills White Roman Catholic Bishop_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kill Arabs, Cry Anti-Semitism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Killer Plays Race Card_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kill the Christians_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kirkby TV Covers Reconquista_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kook Conspiracy Theories - Reject Them_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Kosovo - A Dangerous Cosmetic Salon_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Lamb Gaede - 11-year-old White Girl Stands for Truth in California_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Lambing Flat_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Land Of Dope And Jewry_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
La Pauvre Petite - Schoolgirl abduction-murder rivets France_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Lapdance King, Lawyer Indicted in 'Mafia' Probe_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
La Raza List of Corporate Traitors_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Law Enforcement Embattled in New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Leftist Violence Flares at Norwegian Election Event_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Letter - A Father Pleads for His Son's Future_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Letter from Atlanta - The Seamy Gold Club Trial_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Liberating America From Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Lisa Rad - 2006-02-15 - Fall of the Fourth Reich_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
list-of-jews_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
London - Jewish Mafia Loses Three Soldiers_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
London Mayor Challenges Suspension_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Louisiana - Town's First Black Police Chief Charged in Crack Probe_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Louisiana National Guard Troops Watch Katrina from Iraq_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Louisiana Senator Threatens To Assault Bush_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Low-paid illegal work force has little impact on prices - 2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Low-paid illegal work force has little impact on prices_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
M. P. Shiel - 2006-03-07 - Equality, Democracy, and their Killing Fields_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Madonna Listed Among America's 'Most Powerful Jews'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mali - Africans Still Practice Human Sacrifice_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Marcus Epstein and Michelle Malkin_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Marian Evans -- Catastrophe in Kansas City_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mariel Deja Vu_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mark Weber - 2006-02-10 - Holocaust Survivor Memoir Exposed as Fraud_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mark Weber - 2006-03-16 - The Jewish Role in the Bolshevik Revolution and Russia's Early Soviet Regime_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Marshals - Innocent People Placed On 'Watch List' To Meet Quota_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Marxists Gamble on Geeks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
MaryPhaghanSong_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mass Grave Containing Kosovo Serbs Found_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mass Grave of Massacred Poles Found in Ukraine_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Matthew Downing - 2006-03-24 - Massachusetts - Pro-White Outreach Frustrates Local Media, ADL_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Matthew Hale - Justice Denied_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
mcveigh_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Media Note - 'Michael Savage' Lashes Out Against Nick Berg and His Family_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Medicating heretics_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mel Gibson's Anti-Zionist Priest Dies_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mel Gibson Denounces Jews' War_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Memo Proves Brown Paid for Chertoff's Incompetence_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Merry Christmas -- and on to Victory!_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mestizo Gangs Control the Suburbs_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mestizos too violent for open debate, crowd control impossible_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mexico Conquers Texas_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mexico Ups the Ante in Conflict with American Blacks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Michael Chertoff - 'Trust Us'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Middle Class Families in Worse Shape Than Ever, Study Finds_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Minnesota Shocker - Black Muslim Wins Primary_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Miscegenator Murders White 'Girlfriend' and Unborn Child_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mission Fights Eastern European Sex Slave Traffic_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mistrial for Accused Jewish Mafia Godfather_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mom Gives Kids Dose O’ Diversity_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
More 'Racist' AIDS Statistics_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
More Illegal Aliens Accused in Gang Rapes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
More Jewish Mobsters Arriving_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
More Legal Atrocities Against Serbian Whites_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
More on the Cabbala_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
More on the Orlando Sentinel's Campaign Against Free Speech and Thought_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mothers in Houston Join Katrina Altercation_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
MuadDib's Primer on the Jews_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Multicultural Jihad Wrecks Dutch Racial Harmony_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Multiracial Children Have More Psychological Problems_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Multiracialism and Conservatism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Museum Pulls 'Offensive' Artwork_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Muslim 'Tolerance' Boils Over in Egypt_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Muslims Back Down In Face of White 'Threat'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
My Big Biofuels Bet_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
MY FAREWELL TO ISRAEL_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Mystery of the mummies_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Myths, Misunderstandings, and Outright Lies - gold-confiscation-1933_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
N.O. Cops Suspected of Stealing Up to 200 Cars_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Namibia - Tribe Demands German Reparations_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
National Alliance Speaks at Campus Mideast Forum_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
National Vanguard - Just Say No to Illegal Immigrants_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
National Vanguard Activist Wins Victory Against Censorship_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Negro Accused of Spreading AIDS_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Nerds Join Neo-Cons to Oppose National Vanguard_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Netherlands - Jihadi Plot Upsets Liberals_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Netherlands Braces for 'Jihad'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Africa_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Book Helps White Families Become Prosperous_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Charges for Lightfingers Tom_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New From FEMA - The Looter Relocation Program_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Jersey - Jews Refuse to Vote in Churches_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Jersey Girl Murdered and Dismembered By Mestizos_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Jersey Icebergs and Whores_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Jersey Rabbi Says Katrina Refugees Welcome in Utah_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans - Cops Join in Looting_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans - Second Amendment Suspended_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans - The Rise of 'Mighty Whitey'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans Africa-Like Well Before Hurricane Katrina_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans and 'The Gods of the Copybook Headings'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans Chaos Reveals America on the Brink_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans Corrupt 'Down to the Bone,' Former Pol Charges_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans Descends into Africa-like Savagery_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans Parody Challenges System Media_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Orleans Pays For Affirmative Action_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Report Sheds Light on Hispanics in U.S._files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Sex Scandal Rocks Holy See_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Newspaper Calls Mass-Murder 'Sad' Flier Distribution 'Despicable'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Newsweek - Superlobbyist is Crooked_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New V-TV Video - Katrina Relief_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New Yorkers to study about Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
New York Times - Chertoff Approved Abu Ghraib Interrogation Methods_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Nick Griffin - The Race Murders the Media Ignore_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ninety_five_theses_on_the_holoca - Ninety Five Theses on the Holocaust_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
NJ - Mestizo Cop Helped Drug Ring Say Officials_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
NJ - New Black Panthers Come to Town_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
NJ Ethics Office - Fagan Stole $400,000_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
No, We're Not 'All Israelis Now'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
No Black Day in Jesse's Hometown_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
No Debit Cards for White People_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
noose_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Norman Language Flourishes in the Channel Islands_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
North American Students Trained for 'Merger'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Norway - 19,000 'Asylum' Seekers Evade Authorities_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Norwegian Patriots Demolish Sell-outs_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Norwegians Discover Joys of Islam_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Norwegian Teens Cool to 'Diversity'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Nutty Professor Charged In Hate Crime Hoax_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
NY Times Hit Hard as Controlled Media Take Continued Beating_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Oakland - Black-Yemeni Tension Ratcheted Up_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Oakland - Black Muslim Tensions Heightened_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Oakland - Blacks Loot Burned-Out Shell of Arab Store_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Oakland - Video Beating Victim Comes Forward_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Oakland Beating Video - Cops Baffled_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Oakland Update - Blacks Charged With Hate Crimes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
October 7, 1571 - The Deliverance of Europe at Lepanto_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Of Course There Is an Israel Lobby_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ohio - War Protest Turns Violent_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ohn Lennon's 'Imagine' (revised)_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Once We See Black We NEVER Go Back_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
One Percent of Population Commits Half of Homicides_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
On White Genocide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Over 75,000 AIDS Cases in New York City_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Patric Ewing testifies he twice had oral sex at Gold Club_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Pay No Attention to the Jews Behind the Curtain—the Iron Curtain_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
PC Desecration of Spanish Holy Site_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Peterloo Massacre_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Petty Criminal Leaves Sarkozy Red-Faced_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Poignant Photo Strikes Reader_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Poland Abruptly Cancels a Speech By Critic of the Jewish State_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Police - Hurricane Evacuees Kill Woman who Helped Them_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Police Demand Resignation of Black Commissioner_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Police Looting - Racial Realities Exposed in New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Police Ordered to Stop Looters_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Polish-Americans Celebrate Harvest Festival_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Polish Father of US Cavalry Laid to Rest_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Political Correctness - The Scourge of Our Times_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Political Prisoners - In America_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Poll Shows Rising Tide of anti-Semitism on Eve of Holocaust Day_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Polls Show Opposition to Iraq War at All-Time High_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Powerful Gains For Pro-Whites in Norwegian Elections_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Pre-Traumatic Stress Disorder-A Glimpse Into Israeli Collective Psychosis_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
President Putin - 'Orthodox Christianity an Integral Part of Russian Culture'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Pressure on Chertoff Builds_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Principal Negative Stereotypes Against European Americans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
printer.php_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Pro-Zionist Televangelist Advocates Murder_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Pro and Con - NFL Star Allegedly Runs Over Teens in Stolen Car_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Progress Party Gets It Right_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Prophecy of the Seeress_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Protestants and Catholics Unite -- For a Brown Ireland_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Protests Loom in Far West, Washington_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Prussian Blue and the First Amendment_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Purchasing Precious Metals_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Putin's Cannibals 'Gaffe'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Putin, the Patriot_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Putin - Those Who Bombed Serbia Should Pay Damages_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Putin Pilgrimage Strengthens Greco-Russian Links_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Questions of Preferential Treatment Raised in Sex Case_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Questions That May Not Be Asked About New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Rabbis to Israeli Military - Kill More Non-Jews_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Race-based Medicine Confirms Genetic Differences_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Race and Murder_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Race Baiting as New Orleans Sinks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Race in Ancient Egypt_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Racial Battle-Lines Divide School_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Racial Explosion 60 Years On_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Racialism versus Communitarianism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Racial Media Jump on Katrina News_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Racial Reality and the New Orleans Nightmare_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Racial Test Gap Remains Large in California_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Radical White Intellectual Predicts World-Altering Tempest_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Radio Station Urges 'Kill Tookie' Emails to Schwarzenegger_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ramadan Madness Looms_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Rap King Shot in Florida_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Reading, Writing and Race_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Real Racial Supremacism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Recent Events Show America is Changing_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Refugee Numbers On the Rise_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Religious Group Flagellate Selves Over 'Reparations'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Remember the Turkish Genocide of the Pontic Greeks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Report - Cannibalism in New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Report Illegal Aliens - status_report_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Republicans Back Pro-Homosexual 'Hate Crimes' Expansion_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Resisting Defamation - Principal Negative Stereotypes Against European Americans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Resisting Defamatory Anti-White Language_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Restoring The Small Farm_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
RESULTS OF MINNESOTA TRANSRACIAL ADOPTION STUDY_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Rhode Island - Cops Catch Illegals at Dem Chair's House_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Rockers Demand Recognition of Armenian Genocide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Rosa Brooks - Criticize Israel - You're an Anti-Semite_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Rural Traditions of the Pennsylvania Dutch Still Strong_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Russia - Sophisticated Sex Slave Operation Uncovered_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Russian State Duma Denounces Armenian Genocide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Russian Wealth in Hands of Jews - One Hundred Own Quarter of Wealth as Russians Starve_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Russia Ponders Tax on Childlessness_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
School Officials Look the Other Way When Whites are Abused_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Science Strikes Back_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Scotland - Poseurs Headed for Kneecapping_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Scotland - Race Killing Case Opens_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Seattle Test Scores Anguish_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Sex Offenders Slip Radar_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Sex Rabbi - 'I'll Debate David Duke'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Sharon - The Al Sharpton of the Middle East_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
shelby - Terrorism In South Africa_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Shmuley loses it_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Silver - Why You Should Own It_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Singapore Bloggers Latest Victims of Multicultural Intolerance_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Sinn Fein Touts for Third World Ireland at Westminster_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Sir Gawain and the Green Knight - Indo-European Archetypal Myth_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Slave Account - Fiction_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
So Long Tookie_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Some Comments on 'Racism'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Soros 'An Extremely Evil Person'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
So You Think You're a White Anti-Racist_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
So You Thought the Mob Was Run by Italians_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Specific Sites Excluded from Google.fr and or Google.de_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Spelling Used TV to Push Homosexual Agenda_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Spoof - Byzantine Emperor Apologizes to Muslims For Quote_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
St. George and the Harridan_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
St. Petersburg, FL - ethnic_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Stab in the Back - Israel’s Attack on the USS Liberty_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Stanford - Racial Groupings Match Genetic Profiles_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Steve E Romer - 2006-04-18 - Make Illegal Aliens Felons - That's Not Enough_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Steven E Romer - 2006-02-14 - Tiny Differences, Through Time, are Everything_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Stopping the Unstoppable_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Stop White Genocide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Strangers Among Us_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Strong Showing for BNP_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Subverting the Disney Legacy - Michael Eisner_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Supermob - Sidney Korshak and His Criminal Associates_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Support Freedom of Speech - Wear the Wristband_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Surrounded by Jews, Bush Blasts Mahathir, Says He's 'Wrong' About Jewish Power_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Survey - Israel is Number One Threat to World Peace_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Suspect - My Job Is 'Taking White People's Cars'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Swedes Arrest Alleged 'Anti-Fascist' Terrorist_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Swedes Embrace Inquisition_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Swiss Banks and the Jews - What Happened to the Extra Billion_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Synagogue Desecration Shocks London_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Syrians Snuff Islamist Attack on US_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Take Me to Your Moron_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tampa - When Whites Gather_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tampa Summer Solstice Festival_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Television Pioneer Elma Farnsworth Dies at 98_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Texas Papers Play Up 'Racial' Quotes by Candidate Friedman_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
thadanderson-American_Revolution_Docs/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
thadanderson-Civil_War_Docs/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
thadanderson-WWII_Docs/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
That Which is Good, Shall be Called Evil_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The 'Holocaust' Is A Typical Zionist Myth_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The ADL, Jesus, and Anti-Semitism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The American Nation Part II_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The American Nation_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Anthrax Murders - The Israeli Connection, part 1_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Anthrax Murders - The Israeli Connection, part 2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
THE ARYANS, OR NOBLES_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Barack Obama Myth_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The BBC's One Way Racism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Beast as Saint - The Truth About 'Martin Luther King'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Biological Puzzle of Jewish Behavior_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Changing Face of AIDS_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
THE CHINK IN OUR ARMOR_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Christ-Killers Today_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Color Of Crime And The New Orleans Nightmare_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Confederate Defeat, The Fall Of New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Congo's Atrocious Secret_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dark Side of the Anti-Defamation League, part 1_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dark Side of the Anti-Defamation League, part 2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dark Side of the Anti-Defamation League, part 3_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dark Side of the Anti-Defamation League, part 4_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dark Side of the Anti-Defamation League, part 5_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dark Side of the Anti-Defamation League, part 6_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dark Side of the Anti-Defamation League, part 7_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dark Side of the Anti-Defamation League, part 8_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The De-Zionization of the American Mind_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Deadly Twins_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Destruction of White Youth_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dog Gone Asians_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Drunken Truth_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Dutch Say 'Nee!'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Eternal Value of Privacy_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Factory Farms of Jewish Publishing_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The FCC Scandal_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Forbidden Srebrenica Report - Something The Neo-cons Don't Want You To See_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Fraud of Neoconservative 'Anti-Communism'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Gateway_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Governors Declare An Emergency - Who Cares If They’re Sincere_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Hard Edge of Hatred_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Hidden History of 9-11-2001_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Hollywood Big Lie_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Holocaust Controversy - The Case For Open Debate_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Holy Man and the Ho_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Jewish Declaration of War_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
THE JEWS AND THE CONCENTRATION CAMPS - A FACTUAL APPRAISAL BY THE RED_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Jew Who Fled Rio_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Judas Goats_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Kwanzaa Hoax_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Last Straw - Jewish Death Squads in America_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Leo Frank case_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Liberty Tree_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Love of Ages_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Middle East Initiative_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Missiles at Ground Zero_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Most Corrupt Member of Congress_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Neo-Genocidists_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The New Minority_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Next Victims of Islamic Terror_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Officially Sanctioned Invasion of Greece_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Origins of the White Man - Part II_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Origins of the White Man - Part I_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Origins of the Word 'Racism'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Pope Must Die_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Price White Americans Pay - Never Forget the Hmong Massacre_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Racial Ideology of Empire_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Rednecks Did It!_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
There is No Freedom Without Free Speech_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Rise of the BNP_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Self-Evident Lessons of Madrid_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Shame of Being an American_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Shocking Story of Approved Killing in Mississippi_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Struggle for Caucasia_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Symbiants_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Tapes the Hague Tribunal Hasn't Shown - Muslim Terrorists Massacring Serbs_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Truth About Slavery_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The United States of Barbarism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Weird Wild World of the Zionist Right_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Weird World of Kwanzaa and Other African Hoaxes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Whitewashing of Ariel Sharon_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Winds of Change_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The World is His China Shop and His Shills Make Excuses_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The Wrath of Ka_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
They Want Our Kids_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
The_Jews_in_England_part2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
thinking_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
This Will Come Back to Haunt Us_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Thomas Carlyle and Edward Bulwer-Lytton - Giants of the North_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Thousands Protest Violence in Darfur_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Threats to a Free Internet_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
ThunderDome_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tiny Differences, Through Time, are Everything_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Today Show - Let 'Em Eat Cake_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tonight - Current Issues TV to Host Dr. David Duke_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Toni Morrison - She Simply Can't Write_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tookie's 'Peaceful' Pals Threaten Violence_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tookie Advocate - 'That’s a racist question!'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tookie Finally Ready to Snitch_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Too White, Too Strong_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Top Rabbi - Katrina is God's Punishment for Not Supporting Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tourists Evacuated from Superdome_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Tourists Targeted in New Orleans as Unrest Spreads to Baton Rouge_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Troops Back From Iraq Find Another War Zone_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Troops Find Grisly Scenes in New Orleans Convention Center_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast2_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Turkey, EU Reach Deal for Opening Talks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Turkey Has No Friends; Good for Europe_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Turkish Novelist Faces Jail for ‘Hate Speech’_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Turks Award Zionists with Weapons Contract_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Turks Convict Armenian Journalist of 'Speech Crime'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Turks May Save Drowning Rat_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Two More 'Sexual Indoctrination' Bills Vetoed_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
U.S. Population Nears 300 Million_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
U.S.S. Liberty Crew Reunites_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
U.S. State Department - Israel Plagued by Trafficking_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ugly Lessons from Katrina_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Al Qaeda 'Cleric' Worked for Both Sides_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Birmingham Riots Result of Multicultural Experiment_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Black Gets Prison for al-Qaeda Plot_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - BNP Music Label Launched_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - BNP Picking Up Votes - Viewed as Persecuted Underdog_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - British National Party Chairman Nick Griffin Released_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Censorship by Multiracialists Raises Ugly Head_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Conservatives Fear Nationalist Competition_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - English Town Continues to Suffer From Multiracialism_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Keighley Protest Still On_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Muslims Scream About Ice Cream_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - National Demonstration Against Police Anti-White Racism Planned_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Nov. 2 Free Speech Demo Plan Forges Ahead_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Now It's Griffin_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Police Arrest Anti-White Goon_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Police Investigating Multiracialist Entertainer for Threatening Whites_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Popular Muslim Video Supports Violence Against Non-Believers_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Race Rioting Erupts in Birmingham_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Racial Justice Sunday Staged by Rapidly Shrinking Church_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Secret Police Seize Nationalist Paper_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Top Cop Urges Police To Wear Islamic Battle Colors_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - White Leaders Undaunted by Coordinated Violent Attacks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Whites Furious Over Removal of Memorial To Slain Teenager_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK - Whites Quitting Cities_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK = Church Anger at Islamic Texts_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK Cops Threaten Vet Over Flag_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UK journalist arrested in Israel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ukraine - David Duke Earns Doctorate in History_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ulster - Anti-White Loyalist Thug Slain_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ulster - Loyalists Join Jews in Human Smuggling Ring_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ulster - Religious Fanatics Say No To Catholics, Yes To Non-Whites_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ulster-Scots Culture Enjoys a Renaissance_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
UN Antislavery Day Celebrates Massacre of Whites_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Updated - Who Rules America_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
US - White Poverty Soars_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
US Evangelicals Increasingly Question Pro-Zionist Heresy_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
US Iraq Atrocities Nothing New_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
US Left - Tools of Oligarchs, Zionists, System_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
US Nationalists Record Song for BNP_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
US Provided KLA With Food_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
USS LIBERTY Memorial - AMERICAN LEADERS SUPPORT USS Liberty SURVIVORS_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
USS Liberty Veterans Present Pentagon With Report on Israeli War Crimes_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Usury Perfected_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Utahns Leaving Multiracial Public Schools_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
V-News.org Exclusive - The Plan De San Diego_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Vang Guilty in Hunter Massacre Trial_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Vang Says Three Hunters Deserved to Die_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Vanguard News Network » Blog Archive » Important Thoughts, Financial and Economic Advice_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Vanunu - Israel's Nuclear Arsenal a Threat to Middle East_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Venezuelan Chavez wants to be world's anti-U.S. voice_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Veteran Congressman Paul Findley Exposes Israel’s Lobby_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Vigilantes Attack Elderly Border Protestors_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Viroqua, WI School Board Bans 'Diversity Day'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Voice For Europe - Pan-European Co-ordination Against Turkish EU Membership_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Voices from the Past - Languages of Our Ancestors_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Voodoo Faithful on Annual Pilgrimage_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Voting for Pro-White Parties Is 'Spitting in God's Face'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Wal-Mart Turns in Student’s Anti-Bush Photo, Secret Service Investigates Him_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Waldorf MW I Manuals/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Wales - Win for 'Heretic'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
War Criminal at Bay_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
War Party Atrocity Porn_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
War Signals_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Was Columbus Greek_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
WAS THERE REALLY A HOLOCAUST_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Was WWII Worth It_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Watts Riots 40 Years On_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
We at The Scriptorium_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Welcome, TAA#3 readers - Background on our authors subjects_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Welcome News - Turks May 'Shun' EU Talks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Welcome to the Jungle - Superdome Tales_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Wendy Campbell - 2006-09-11 - Parallels between Nazism, Zionists striking_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
We The People_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What's in the New Orleans Water_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What's This About 'Peak Oil'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What's Your Diversity Quotient_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What About 'Affirmative Action' for US Media Ownership_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What Does Israel Want_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What is National Vanguard_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What is So Wrong With White People_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What Makes Palestinians Think They Can_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What Makes Western Culture Unique_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What will become of the ‘American Dream’_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
What Would War Look Like_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Wheat and Chaff_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
When Al Qaeda Was An Ally of 'the West'_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Which Way, Milwaukee_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White America starts winning_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White Children Experience Slavery at Summer Camp_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White Heritage Sites Threatened on Cyprus_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White India_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White Interests_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White People's Party Forms in Nevada_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White Science, Black Humor_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White Slavery Focus of New Book_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Whites Make Stand at Superdome_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Whites Organize in Namibia_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Whites Repulse Turks in Georgian Waters_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Whites Suffering in New Orleans_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White Teen Dragged from Bus, Beaten, and Robbed by Anti-White Gang Members_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
White Wire Newsblog » A History of Kwanza by Ann Coulter…and a Special Kwanza Jingle From the White Wire Staff_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Who Rules America_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Who We Sold the Serbs To_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Why Hitler Attacked Soviet Russia When He Did_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Why Islam Didn't Conquer the World_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Why Israel’s Campaign in Lebanon is Failing_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Why Scandinavia Tops U.N. Standard of Living Index_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
wiesenthal - fake holocaust_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Wisconsin - New Flood of Hmong Refugees Will Strain Already Tight Budgets_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Wisconsin - Rampage Killer, Friends Now Suspects in 2001 Homicide_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Witnesses - New Orleans Cops are Looters_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Worldwide Lack of Concern Over Israel's White Slave Trade_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
www.iraqthejewswar.com/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Ygg/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
YGGDRASIL - Lesson Number One_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Youth Gang Rape Reported in Milwaukee_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Zimbabwe - Armed Police Stealing Farm Equipment_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Zimbabwe - Monkey Behind Famine_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Zionists Cheer Creep DeLay_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Zionist Shill's Mistake Endangers Family_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Zionists Show Contempt For Christians_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Zionists Slam Greeks_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Zionists Threaten Leader with Occult Ritual Murder_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
Zionist Televangelist Paid Hush Money in 'Gay' Scandal_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
zogencryption_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
‘Patriotism’ is the Last Refuge of the Scoundrel_files/ |
<Directory> |
<Directory> |
Oct 5 2015 1:52 AM |
'Affirmative Action' Chief Latest 'Victim' of Katrina.htm |
HTML File |
3 KB |
Oct 2 2012 12:31 AM |
'Anti-Semitism' Center Set Up at Yale.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:30 AM |
'Border Baby' Boom Strains South Texas.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:28 AM |
'Down Low' Lifestyle Causing AIDS Epidemic Among Blacks.htm |
HTML File |
6.6 KB |
Oct 2 2012 12:33 AM |
'Down Low' Lifestyle Suspected in Porn Industry HIV Scare.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:33 AM |
'Feldman' Attack on 'Passion' is a Hoax.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:27 AM |
'Gay' Groups Fight Parents Over School's Mandatory Homosexual Indoctrination.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:29 AM |
'Governator' Refuses Tookie Clemency.htm |
HTML File |
24.1 KB |
Oct 2 2012 12:32 AM |
'Hate crime' victims - Young, poor, white - 2006-02-22.txt |
Text File |
4.3 KB |
Oct 2 2012 12:28 AM |
'IQ' vs. Standardized Tests.htm |
HTML File |
149.1 KB |
Oct 2 2012 12:27 AM |
'I Was a Victim of Racial Violence in Junior High'.htm |
HTML File |
7 KB |
Oct 2 2012 12:30 AM |
'Madonna' - Diva of Degeneracy to Perform in Israel.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:31 AM |
'Mighty Whitey' Defends Algiers Point.htm |
HTML File |
4 KB |
Oct 2 2012 12:30 AM |
'Mud Duck' - Vang Trial Hits Emotional Peak.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:30 AM |
'Neutral' Official to KLA - 'Careful With Those Grenades'.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:34 AM |
'Sugar daddies' fuelling HIV spread.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:32 AM |
'The Jews are being pulled from their palaces, decapitated, and fed to the dogs'.htm |
HTML File |
6.8 KB |
Oct 2 2012 12:33 AM |
'Tolerance' Runs Out for Firm.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
'Voices of Heaven' Ordered Not to Sing Sacred Music.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:33 AM |
0,,31580,00.html |
HTML File |
1.2 KB |
Oct 2 2012 12:28 AM |
2 standards for diversity in the legal fraternity.htm |
HTML File |
5 KB |
Oct 2 2012 12:28 AM |
2_On_Being_White.PDF |
PDF Document |
275.9 KB |
Oct 2 2012 12:31 AM |
6millionmyth.pdf |
PDF Document |
181.8 KB |
Oct 2 2012 12:28 AM |
6millionmyth.rtf |
RTF File |
214.9 KB |
Oct 2 2012 12:28 AM |
9-11 Families Demand Action on Immigration.htm |
HTML File |
3 KB |
Oct 2 2012 12:30 AM |
13tribe.pdf |
PDF Document |
445.6 KB |
Oct 2 2012 12:32 AM |
13tribe.rtf |
RTF File |
1.8 MB |
Oct 2 2012 12:28 AM |
15,000 Hmong Head for Minnesota.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:31 AM |
16.3allen.pdf.htm |
HTML File |
8.2 KB |
Oct 2 2012 12:28 AM |
16CrucifiedSaviors.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:31 AM |
36-ferrocement-water-tanks.pdf |
PDF Document |
203.2 KB |
Oct 2 2012 12:34 AM |
50 Cent Gives New Meaning to 'Da Bomb'.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:32 AM |
53-francis.pdf |
PDF Document |
177.4 KB |
Oct 2 2012 12:34 AM |
53-km-slezkine.pdf |
PDF Document |
273 KB |
Oct 2 2012 12:34 AM |
53-wch-script.pdf |
PDF Document |
265.2 KB |
Oct 2 2012 12:32 AM |
66QnA.pdf |
PDF Document |
48 KB |
Oct 2 2012 12:32 AM |
72.3bentley.pdf.htm |
HTML File |
7.1 KB |
Oct 2 2012 12:28 AM |
80 BC - The White World’s Oldest Computer.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:33 AM |
88Precepts.pdf |
PDF Document |
20.5 KB |
Oct 2 2012 12:31 AM |
88Precepts.rtf |
RTF File |
36.6 KB |
Oct 2 2012 12:31 AM |
90December.pdf |
PDF Document |
420.7 KB |
Oct 2 2012 12:30 AM |
90November.pdf |
PDF Document |
306 KB |
Oct 2 2012 12:30 AM |
91April.pdf |
PDF Document |
485.3 KB |
Oct 2 2012 12:30 AM |
91February.pdf |
PDF Document |
334.1 KB |
Oct 2 2012 12:31 AM |
91January.pdf |
PDF Document |
345.9 KB |
Oct 2 2012 12:27 AM |
91July.pdf |
PDF Document |
416.7 KB |
Oct 2 2012 12:29 AM |
91March.pdf |
PDF Document |
358.9 KB |
Oct 2 2012 12:30 AM |
94June.pdf |
PDF Document |
587.9 KB |
Oct 2 2012 12:28 AM |
95February.pdf |
PDF Document |
450 KB |
Oct 2 2012 12:30 AM |
95March.pdf |
PDF Document |
515.1 KB |
Oct 2 2012 12:30 AM |
96August.pdf |
PDF Document |
632.8 KB |
Oct 2 2012 12:31 AM |
96December.pdf |
PDF Document |
514.2 KB |
Oct 2 2012 12:31 AM |
96January.pdf |
PDF Document |
441.5 KB |
Oct 2 2012 12:31 AM |
96July.pdf |
PDF Document |
629.8 KB |
Oct 2 2012 12:30 AM |
96June.pdf |
PDF Document |
554.3 KB |
Oct 2 2012 12:30 AM |
96November.pdf |
PDF Document |
487.2 KB |
Oct 2 2012 12:33 AM |
96October.pdf |
PDF Document |
746.1 KB |
Oct 2 2012 12:33 AM |
96September.pdf |
PDF Document |
494.2 KB |
Oct 2 2012 12:31 AM |
97April.pdf |
PDF Document |
455 KB |
Oct 2 2012 12:31 AM |
97December.pdf |
PDF Document |
495.1 KB |
Oct 2 2012 12:33 AM |
97February.pdf |
PDF Document |
440.6 KB |
Oct 2 2012 12:33 AM |
97January.pdf |
PDF Document |
462.3 KB |
Oct 2 2012 12:28 AM |
97Jul-Aug.pdf |
PDF Document |
980.7 KB |
Oct 2 2012 12:33 AM |
97June.pdf |
PDF Document |
458.2 KB |
Oct 2 2012 12:31 AM |
97March.pdf |
PDF Document |
477.8 KB |
Oct 2 2012 12:28 AM |
97May.pdf |
PDF Document |
585 KB |
Oct 2 2012 12:32 AM |
97November.pdf |
PDF Document |
557.5 KB |
Oct 2 2012 12:31 AM |
97October.pdf |
PDF Document |
493.6 KB |
Oct 2 2012 12:32 AM |
97September(1).pdf |
PDF Document |
501.5 KB |
Oct 2 2012 12:32 AM |
97September.pdf |
PDF Document |
501.5 KB |
Oct 2 2012 12:28 AM |
98April.pdf |
PDF Document |
558 KB |
Oct 2 2012 12:28 AM |
98August.pdf |
PDF Document |
541.6 KB |
Oct 2 2012 12:32 AM |
98December.pdf |
PDF Document |
845.4 KB |
Oct 2 2012 12:34 AM |
98February.pdf |
PDF Document |
641.5 KB |
Oct 2 2012 12:27 AM |
98January.pdf |
PDF Document |
488.9 KB |
Oct 2 2012 12:29 AM |
98July.pdf |
PDF Document |
548.3 KB |
Oct 2 2012 12:27 AM |
98June.pdf |
PDF Document |
337.8 KB |
Oct 2 2012 12:31 AM |
98March(1).pdf |
PDF Document |
513.6 KB |
Oct 2 2012 12:32 AM |
98March.pdf |
PDF Document |
513.6 KB |
Oct 2 2012 12:29 AM |
98May.pdf |
PDF Document |
426 KB |
Oct 2 2012 12:32 AM |
98November.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:31 AM |
98October.pdf |
PDF Document |
687.2 KB |
Oct 2 2012 12:28 AM |
98September.pdf |
PDF Document |
619.8 KB |
Oct 2 2012 12:31 AM |
99April.pdf |
PDF Document |
316.4 KB |
Oct 2 2012 12:32 AM |
99August.pdf |
PDF Document |
262.1 KB |
Oct 2 2012 12:27 AM |
99December.pdf |
PDF Document |
415 KB |
Oct 2 2012 12:28 AM |
99February.pdf |
PDF Document |
295.6 KB |
Oct 2 2012 12:33 AM |
99January.pdf |
PDF Document |
360.8 KB |
Oct 2 2012 12:31 AM |
99July.pdf |
PDF Document |
320.6 KB |
Oct 2 2012 12:29 AM |
99June.pdf |
PDF Document |
284.5 KB |
Oct 2 2012 12:31 AM |
99March.pdf |
PDF Document |
282.8 KB |
Oct 2 2012 12:33 AM |
99May.pdf |
PDF Document |
270.1 KB |
Oct 2 2012 12:32 AM |
99November.pdf |
PDF Document |
329.7 KB |
Oct 2 2012 12:34 AM |
99October.pdf |
PDF Document |
270 KB |
Oct 2 2012 12:31 AM |
99September.pdf |
PDF Document |
271.5 KB |
Oct 2 2012 12:30 AM |
100 Million Dead - JEWS AND COMMUNISM Part 1.htm |
HTML File |
42.3 KB |
Oct 2 2012 12:28 AM |
100 Million Dead - JEWS AND COMMUNISM Part 2.htm |
HTML File |
41.3 KB |
Oct 2 2012 12:33 AM |
100 Million Dead - JEWS AND COMMUNISM Part 3.htm |
HTML File |
38.5 KB |
Oct 2 2012 12:28 AM |
100ReasonsWereGladToBeMen.pdf |
PDF Document |
6.5 KB |
Oct 2 2012 12:32 AM |
100waystolivefree.pdf |
PDF Document |
39.7 KB |
Oct 2 2012 12:31 AM |
105HolocaustQuestions.pdf |
PDF Document |
94.1 KB |
Oct 2 2012 12:30 AM |
110.Eine_niedere_Form.pdf |
PDF Document |
101.4 KB |
Oct 2 2012 12:33 AM |
110.Geistige_Behinderung.pdf |
PDF Document |
159.9 KB |
Oct 2 2012 12:32 AM |
131Sample.pdf |
PDF Document |
294.1 KB |
Oct 2 2012 12:30 AM |
0208issue.html |
HTML File |
158.6 KB |
Oct 2 2012 12:28 AM |
0209issue.html |
HTML File |
125.6 KB |
Oct 2 2012 12:28 AM |
0210issue.html |
HTML File |
145.3 KB |
Oct 2 2012 12:32 AM |
0211issue.html |
HTML File |
135.3 KB |
Oct 2 2012 12:28 AM |
0212issue.html |
HTML File |
136.7 KB |
Oct 2 2012 12:29 AM |
260 million CHRISTIAN Lives Lost.htm |
HTML File |
53.1 KB |
Oct 2 2012 12:31 AM |
0301issue.html |
HTML File |
147.6 KB |
Oct 2 2012 12:31 AM |
0302issue.html |
HTML File |
136.1 KB |
Oct 2 2012 12:34 AM |
0303issue.html |
HTML File |
143.1 KB |
Oct 2 2012 12:31 AM |
0304issue.html |
HTML File |
139.3 KB |
Oct 2 2012 12:32 AM |
0305issue.html |
HTML File |
142.7 KB |
Oct 2 2012 12:33 AM |
0306issue.html |
HTML File |
155.3 KB |
Oct 2 2012 12:30 AM |
0307issue.html |
HTML File |
155 KB |
Oct 2 2012 12:30 AM |
0308issue.html |
HTML File |
156.4 KB |
Oct 2 2012 12:33 AM |
0309issue.html |
HTML File |
147.5 KB |
Oct 2 2012 12:33 AM |
0310issue.html |
HTML File |
113.2 KB |
Oct 2 2012 12:32 AM |
0311issue.html |
HTML File |
150.6 KB |
Oct 2 2012 12:33 AM |
0312issue.htm |
HTML File |
137.1 KB |
Oct 2 2012 12:31 AM |
365days.pdf |
PDF Document |
13.6 MB |
Oct 2 2012 12:30 AM |
0401issue.html |
HTML File |
150 KB |
Oct 2 2012 12:31 AM |
0402issue.html |
HTML File |
147.3 KB |
Oct 2 2012 12:30 AM |
0403issue.html |
HTML File |
144.2 KB |
Oct 2 2012 12:30 AM |
0404issue.html |
HTML File |
154.2 KB |
Oct 2 2012 12:31 AM |
0405issue.html |
HTML File |
143.6 KB |
Oct 2 2012 12:30 AM |
0406issue.html |
HTML File |
151.1 KB |
Oct 2 2012 12:29 AM |
0407issue.html |
HTML File |
143.7 KB |
Oct 2 2012 12:27 AM |
0408issue.html |
HTML File |
147.6 KB |
Oct 2 2012 12:30 AM |
0409issue.html |
HTML File |
153.4 KB |
Oct 2 2012 12:28 AM |
0410issue.html |
HTML File |
153.1 KB |
Oct 2 2012 12:28 AM |
0411issue.htm |
HTML File |
147.7 KB |
Oct 2 2012 12:33 AM |
0412issue.html |
HTML File |
142.7 KB |
Oct 2 2012 12:32 AM |
0506wiesendemo.pdf |
PDF Document |
226.2 KB |
Oct 2 2012 12:29 AM |
911issue.html |
HTML File |
61 KB |
Oct 2 2012 12:32 AM |
911report.pdf |
PDF Document |
7.2 MB |
Oct 2 2012 12:28 AM |
911report.rtf |
RTF File |
14.6 MB |
Oct 2 2012 12:34 AM |
912issue.html |
HTML File |
59.2 KB |
Oct 2 2012 12:30 AM |
913issue.html |
HTML File |
59.9 KB |
Oct 2 2012 12:32 AM |
914issue.html |
HTML File |
57.1 KB |
Oct 2 2012 12:28 AM |
915issue.html |
HTML File |
61.5 KB |
Oct 2 2012 12:34 AM |
916issue.html |
HTML File |
66.4 KB |
Oct 2 2012 12:28 AM |
921issue.html |
HTML File |
75.8 KB |
Oct 2 2012 12:28 AM |
922issue.html |
HTML File |
63.7 KB |
Oct 2 2012 12:34 AM |
923issue.html |
HTML File |
65 KB |
Oct 2 2012 12:29 AM |
924issue.html |
HTML File |
61.3 KB |
Oct 2 2012 12:33 AM |
925issue.html |
HTML File |
64.1 KB |
Oct 2 2012 12:28 AM |
926issue.html |
HTML File |
74.1 KB |
Oct 2 2012 12:34 AM |
927issue.html |
HTML File |
60.8 KB |
Oct 2 2012 12:29 AM |
928issue.html |
HTML File |
62.7 KB |
Oct 2 2012 12:31 AM |
931issue.html |
HTML File |
63.6 KB |
Oct 2 2012 12:31 AM |
932issue.html |
HTML File |
59.3 KB |
Oct 2 2012 12:33 AM |
933issue.html |
HTML File |
60.5 KB |
Oct 2 2012 12:28 AM |
934issue.html |
HTML File |
62.1 KB |
Oct 2 2012 12:31 AM |
935issue.html |
HTML File |
62.3 KB |
Oct 2 2012 12:31 AM |
936issue.html |
HTML File |
60.6 KB |
Oct 2 2012 12:28 AM |
937issue.html |
HTML File |
60.7 KB |
Oct 2 2012 12:31 AM |
938issue.html |
HTML File |
61.1 KB |
Oct 2 2012 12:28 AM |
939issue.html |
HTML File |
119.7 KB |
Oct 2 2012 12:34 AM |
941issue.html |
HTML File |
63.6 KB |
Oct 2 2012 12:30 AM |
942issue.html |
HTML File |
57.5 KB |
Oct 2 2012 12:32 AM |
943issue.html |
HTML File |
59.3 KB |
Oct 2 2012 12:33 AM |
944issue.html |
HTML File |
56.9 KB |
Oct 2 2012 12:34 AM |
945issue.html |
HTML File |
58.7 KB |
Oct 2 2012 12:30 AM |
946issue.html |
HTML File |
56.8 KB |
Oct 2 2012 12:33 AM |
947issue.html |
HTML File |
64 KB |
Oct 2 2012 12:34 AM |
948issue.html |
HTML File |
70 KB |
Oct 2 2012 12:34 AM |
949issue.html |
HTML File |
71.7 KB |
Oct 2 2012 12:31 AM |
951issue.html |
HTML File |
78.4 KB |
Oct 2 2012 12:28 AM |
952issue.html |
HTML File |
82.6 KB |
Oct 2 2012 12:28 AM |
953issue.html |
HTML File |
80.5 KB |
Oct 2 2012 12:34 AM |
954issue.html |
HTML File |
75.8 KB |
Oct 2 2012 12:31 AM |
955issue.html |
HTML File |
78.2 KB |
Oct 2 2012 12:32 AM |
956issue.html |
HTML File |
76.3 KB |
Oct 2 2012 12:31 AM |
957issue.html |
HTML File |
80.3 KB |
Oct 2 2012 12:27 AM |
958issue.html |
HTML File |
79.5 KB |
Oct 2 2012 12:30 AM |
959issue.html |
HTML File |
80.9 KB |
Oct 2 2012 12:30 AM |
961issue.html |
HTML File |
81.4 KB |
Oct 2 2012 12:33 AM |
962issue.html |
HTML File |
82.4 KB |
Oct 2 2012 12:28 AM |
963issue.html |
HTML File |
77.7 KB |
Oct 2 2012 12:28 AM |
964issue.html |
HTML File |
78.3 KB |
Oct 2 2012 12:28 AM |
965issue.html |
HTML File |
75.7 KB |
Oct 2 2012 12:32 AM |
966issue.html |
HTML File |
70 KB |
Oct 2 2012 12:33 AM |
967issue.html |
HTML File |
79.4 KB |
Oct 2 2012 12:31 AM |
968issue.html |
HTML File |
73.7 KB |
Oct 2 2012 12:28 AM |
969issue.html |
HTML File |
77.5 KB |
Oct 2 2012 12:33 AM |
971issue.html |
HTML File |
83.3 KB |
Oct 2 2012 12:29 AM |
972issue.html |
HTML File |
81.1 KB |
Oct 2 2012 12:30 AM |
973issue.html |
HTML File |
92.1 KB |
Oct 2 2012 12:32 AM |
974issue.html |
HTML File |
79.7 KB |
Oct 2 2012 12:34 AM |
975issue.html |
HTML File |
77 KB |
Oct 2 2012 12:34 AM |
976issue.html |
HTML File |
87.7 KB |
Oct 2 2012 12:31 AM |
979issue.html |
HTML File |
84.7 KB |
Oct 2 2012 12:33 AM |
981issue.html |
HTML File |
89.1 KB |
Oct 2 2012 12:33 AM |
982issue.html |
HTML File |
93.9 KB |
Oct 2 2012 12:27 AM |
983issue.html |
HTML File |
84.6 KB |
Oct 2 2012 12:28 AM |
984issue.html |
HTML File |
82.2 KB |
Oct 2 2012 12:31 AM |
985issue.html |
HTML File |
78.4 KB |
Oct 2 2012 12:33 AM |
986issue.html |
HTML File |
77.2 KB |
Oct 2 2012 12:33 AM |
987issue.html |
HTML File |
82.1 KB |
Oct 2 2012 12:30 AM |
988issue.html |
HTML File |
76.2 KB |
Oct 2 2012 12:34 AM |
989issue.html |
HTML File |
77.8 KB |
Oct 2 2012 12:31 AM |
991issue.html |
HTML File |
119.4 KB |
Oct 2 2012 12:31 AM |
992issue.html |
HTML File |
111 KB |
Oct 2 2012 12:33 AM |
993issue.html |
HTML File |
118.3 KB |
Oct 2 2012 12:28 AM |
994issue.html |
HTML File |
111.1 KB |
Oct 2 2012 12:30 AM |
995issue.html |
HTML File |
76.8 KB |
Oct 2 2012 12:33 AM |
996issue.html |
HTML File |
85.3 KB |
Oct 2 2012 12:31 AM |
997issue.html |
HTML File |
102.9 KB |
Oct 2 2012 12:28 AM |
998issue.html |
HTML File |
85 KB |
Oct 2 2012 12:31 AM |
999issue.html |
HTML File |
111.2 KB |
Oct 2 2012 12:28 AM |
1984.pdf |
PDF Document |
564.4 KB |
Oct 2 2012 12:28 AM |
1984.rtf |
RTF File |
712.5 KB |
Oct 2 2012 12:33 AM |
1984.zip |
ZIP Archive |
367.4 KB |
Oct 2 2012 12:33 AM |
2005-12-07 - Wanted - More Race Realism, Less Moralistic.htm |
HTML File |
44.9 KB |
Oct 2 2012 12:28 AM |
2005-12-07 - wanted_more_race_realism_less.php.htm |
HTML File |
362.8 KB |
Oct 2 2012 12:28 AM |
5700IsraelAid.pdf |
PDF Document |
138.8 KB |
Oct 2 2012 12:33 AM |
9011issue.html |
HTML File |
60.4 KB |
Oct 2 2012 12:31 AM |
9012issue.html |
HTML File |
60.5 KB |
Oct 2 2012 12:30 AM |
9107issue.html |
HTML File |
60.5 KB |
Oct 2 2012 12:33 AM |
9108issue.html |
HTML File |
64.1 KB |
Oct 2 2012 12:34 AM |
9109issue.html |
HTML File |
56 KB |
Oct 2 2012 12:33 AM |
9110issue.html |
HTML File |
67.2 KB |
Oct 2 2012 12:33 AM |
9111issue.html |
HTML File |
58.1 KB |
Oct 2 2012 12:33 AM |
9112issue.html |
HTML File |
62.5 KB |
Oct 2 2012 12:33 AM |
9209issue.html |
HTML File |
62.1 KB |
Oct 2 2012 12:28 AM |
9210issue.html |
HTML File |
65 KB |
Oct 2 2012 12:33 AM |
9211issue.html |
HTML File |
62 KB |
Oct 2 2012 12:33 AM |
9212issue.html |
HTML File |
62.9 KB |
Oct 2 2012 12:30 AM |
9311issue.html |
HTML File |
60.5 KB |
Oct 2 2012 12:27 AM |
9312issue.html |
HTML File |
58.7 KB |
Oct 2 2012 12:34 AM |
9410issue.html |
HTML File |
61.5 KB |
Oct 2 2012 12:29 AM |
9411issue.html |
HTML File |
65.6 KB |
Oct 2 2012 12:30 AM |
9412issue.html |
HTML File |
74.2 KB |
Oct 2 2012 12:29 AM |
9501ar.pdf |
PDF Document |
434.4 KB |
Oct 2 2012 12:33 AM |
9510issue.html |
HTML File |
79.5 KB |
Oct 2 2012 12:32 AM |
9511issue.html |
HTML File |
80.7 KB |
Oct 2 2012 12:31 AM |
9512issue.html |
HTML File |
76.6 KB |
Oct 2 2012 12:33 AM |
9610issue.html |
HTML File |
74.1 KB |
Oct 2 2012 12:32 AM |
9611issue.html |
HTML File |
78.7 KB |
Oct 2 2012 12:32 AM |
9612issue.html |
HTML File |
80.1 KB |
Oct 2 2012 12:32 AM |
9710issue.html |
HTML File |
81.6 KB |
Oct 2 2012 12:32 AM |
9711issue.html |
HTML File |
80.8 KB |
Oct 2 2012 12:32 AM |
9712issue.html |
HTML File |
104.5 KB |
Oct 2 2012 12:31 AM |
9778issue.html |
HTML File |
172.9 KB |
Oct 2 2012 12:28 AM |
9810issue.html |
HTML File |
75 KB |
Oct 2 2012 12:30 AM |
9811issue.html |
HTML File |
73.8 KB |
Oct 2 2012 12:32 AM |
9812issue.html |
HTML File |
74.5 KB |
Oct 2 2012 12:27 AM |
9910issue.html |
HTML File |
77.4 KB |
Oct 2 2012 12:32 AM |
9911issue.html |
HTML File |
79.9 KB |
Oct 2 2012 12:29 AM |
9912issue.html |
HTML File |
100.2 KB |
Oct 2 2012 12:34 AM |
41839.web.pdf |
PDF Document |
11 KB |
Oct 2 2012 12:32 AM |
45777355.html |
HTML File |
30.9 KB |
Oct 2 2012 12:28 AM |
Abandoned and Betrayed.htm |
HTML File |
5.3 KB |
Oct 2 2012 12:30 AM |
Abandoned Gold Standard Guarantees Inflation.htm |
HTML File |
15.1 KB |
Oct 2 2012 12:31 AM |
ABC Targets White Children.htm |
HTML File |
7.6 KB |
Oct 2 2012 12:29 AM |
about - THE CHURCH OF TRUE ISRAEL.html |
HTML File |
6.8 KB |
Oct 2 2012 12:34 AM |
Accused Negro Sniper to 'Question' His White Victim.htm |
HTML File |
1.8 KB |
Oct 2 2012 12:31 AM |
ACLU Top Heavy with Jews.htm |
HTML File |
6.8 KB |
Oct 2 2012 12:27 AM |
adaptanddie.pdf |
PDF Document |
365.1 KB |
Oct 2 2012 12:31 AM |
adaptanddie.rtf |
RTF File |
186.3 KB |
Oct 2 2012 12:28 AM |
A Date with Bevin.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:28 AM |
ADL's Foxman - New Testament is Anti-Semitic.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:28 AM |
ADL Anti-Defamation League of B'nai B'rith conducts smear campaigns - ADL Anti-Defamation League of B'nai B'rith is caught in cover-up of its crimes.htm |
HTML File |
57.5 KB |
Oct 2 2012 12:34 AM |
ADL Briefs U.S. House on Internet 'Hate'.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:33 AM |
ADL Champions Gay Marriage, Calls Opponents 'Ugly Bigots'.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:31 AM |
ADL Demands Gulag for Dissenters.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:34 AM |
adlfactsheet1.pdf |
PDF Document |
188.6 KB |
Oct 2 2012 12:27 AM |
ADL Führer Warns of 'Intermarriage' and Public Schooling.htm |
HTML File |
5.5 KB |
Oct 2 2012 12:28 AM |
ADL Opponents Officially Designated As 'Terrorist Organizations'.htm |
HTML File |
6.5 KB |
Oct 2 2012 12:27 AM |
Adorno's Bastards and the Frankfurt School.htm |
HTML File |
53.2 KB |
Oct 2 2012 12:32 AM |
Ads Declare Population Driven Environmental Crisis In California.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:30 AM |
adv-music.html |
HTML File |
2.7 KB |
Oct 2 2012 12:34 AM |
adv-tapes.html |
HTML File |
9.1 KB |
Oct 2 2012 12:33 AM |
adv010194.html |
HTML File |
21.7 KB |
Oct 2 2012 12:29 AM |
adv010894.html |
HTML File |
16.9 KB |
Oct 2 2012 12:29 AM |
adv011594.html |
HTML File |
17.5 KB |
Oct 2 2012 12:33 AM |
adv012994.html |
HTML File |
21.2 KB |
Oct 2 2012 12:28 AM |
adv020594.html |
HTML File |
18.1 KB |
Oct 2 2012 12:31 AM |
adv021994.html |
HTML File |
19.9 KB |
Oct 2 2012 12:33 AM |
adv022093.html |
HTML File |
19.3 KB |
Oct 2 2012 12:31 AM |
adv022496.html |
HTML File |
15.3 KB |
Oct 2 2012 12:31 AM |
adv022793.html |
HTML File |
17.8 KB |
Oct 2 2012 12:34 AM |
adv030594.html |
HTML File |
19.9 KB |
Oct 2 2012 12:30 AM |
adv031294.html |
HTML File |
20.1 KB |
Oct 2 2012 12:30 AM |
adv031393.html |
HTML File |
19.3 KB |
Oct 2 2012 12:28 AM |
adv031994.html |
HTML File |
22.3 KB |
Oct 2 2012 12:31 AM |
adv032093.html |
HTML File |
17.4 KB |
Oct 2 2012 12:32 AM |
adv040293.html |
HTML File |
18.3 KB |
Oct 2 2012 12:28 AM |
adv040393.html |
HTML File |
6 KB |
Oct 2 2012 12:33 AM |
adv041093.html |
HTML File |
15.9 KB |
Oct 2 2012 12:27 AM |
adv042493.html |
HTML File |
18.9 KB |
Oct 2 2012 12:31 AM |
adv043094.html |
HTML File |
17.4 KB |
Oct 2 2012 12:28 AM |
adv050193.html |
HTML File |
19.9 KB |
Oct 2 2012 12:29 AM |
adv050794.html |
HTML File |
18.2 KB |
Oct 2 2012 12:28 AM |
adv052993.html |
HTML File |
18.7 KB |
Oct 2 2012 12:30 AM |
adv060593.html |
HTML File |
19.7 KB |
Oct 2 2012 12:28 AM |
adv061293.html |
HTML File |
21.6 KB |
Oct 2 2012 12:28 AM |
adv061993.html |
HTML File |
20.7 KB |
Oct 2 2012 12:30 AM |
adv071093a.html |
HTML File |
17.8 KB |
Oct 2 2012 12:28 AM |
adv071093b.html |
HTML File |
20.4 KB |
Oct 2 2012 12:30 AM |
adv072493.html |
HTML File |
20.3 KB |
Oct 2 2012 12:28 AM |
adv080793.html |
HTML File |
21.4 KB |
Oct 2 2012 12:29 AM |
adv081493.html |
HTML File |
20.4 KB |
Oct 2 2012 12:34 AM |
adv082193.html |
HTML File |
20.3 KB |
Oct 2 2012 12:30 AM |
adv082893.html |
HTML File |
19.9 KB |
Oct 2 2012 12:33 AM |
adv091193.html |
HTML File |
19.1 KB |
Oct 2 2012 12:34 AM |
adv091893.html |
HTML File |
16.5 KB |
Oct 2 2012 12:31 AM |
adv092593.html |
HTML File |
18.7 KB |
Oct 2 2012 12:33 AM |
adv10-15-05.pdf |
PDF Document |
296 KB |
Oct 2 2012 12:33 AM |
adv100293.html |
HTML File |
19.7 KB |
Oct 2 2012 12:33 AM |
adv100792.html |
HTML File |
19.3 KB |
Oct 2 2012 12:32 AM |
adv101594.html |
HTML File |
60.8 KB |
Oct 2 2012 12:30 AM |
adv102393.html |
HTML File |
20.1 KB |
Oct 2 2012 12:30 AM |
adv103093.html |
HTML File |
17.2 KB |
Oct 2 2012 12:31 AM |
adv110693.html |
HTML File |
17.6 KB |
Oct 2 2012 12:31 AM |
adv111393.html |
HTML File |
18.1 KB |
Oct 2 2012 12:27 AM |
adv120493.html |
HTML File |
17.9 KB |
Oct 2 2012 12:33 AM |
adv122593.html |
HTML File |
19.9 KB |
Oct 2 2012 12:30 AM |
Advice on building an electric car for those interested.htm |
HTML File |
96 KB |
Oct 2 2012 12:31 AM |
aet.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:33 AM |
Africa In Our Midst - Lessons From Katrina.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
African 'Culture' Spreads HIV.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:32 AM |
After Millennia in India, Lost Tribe Returns to Israel.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
after_apartheid.pdf |
PDF Document |
770.4 KB |
Oct 2 2012 12:28 AM |
agapintestscoresbecomesatalkingpoint.html |
HTML File |
7.5 KB |
Oct 2 2012 12:33 AM |
AgentProvocateur.pdf |
PDF Document |
6.8 KB |
Oct 2 2012 12:33 AM |
Agitprop.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:31 AM |
A Great Day in L.A..htm |
HTML File |
9.5 KB |
Oct 2 2012 12:31 AM |
A Group of Friends - Magnet For A Lonely America.htm |
HTML File |
6.8 KB |
Oct 2 2012 12:33 AM |
aids.pdf |
PDF Document |
260.9 KB |
Oct 2 2012 12:34 AM |
AIDS Alert! Avoid Sugar Daddies!.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:33 AM |
AIDS Epidemic Among Black Elite.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:33 AM |
aidsworkersbattlemythandignorance.html |
HTML File |
6.5 KB |
Oct 2 2012 12:27 AM |
aidtoisrael.pdf |
PDF Document |
96.2 KB |
Oct 2 2012 12:34 AM |
AIPAC, the Religious Right and American Foreign Policy.htm |
HTML File |
33.8 KB |
Oct 2 2012 12:28 AM |
AIPAC Congratulates Itself on the Slaughter in Lebanon.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:33 AM |
AIPAC Espionage Case Dismissal Gambit Fails.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:31 AM |
AIPAC Scandal Breaks Loose.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:29 AM |
AIPAC Warns Dems Not to Appear at Anti-war Demo.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:30 AM |
airport_flier_1.pdf |
PDF Document |
238.6 KB |
Oct 2 2012 12:33 AM |
Alabama - Immigrants Make School Rolls Larger than Town.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:33 AM |
Alan Stang - 2004-01-16 - 'Martin Luther' King - Communist Fraud.htm |
HTML File |
26.6 KB |
Oct 2 2012 12:28 AM |
Ali G Worries ADL.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:33 AM |
Alleged Racial-Beating Victim Admits Concocting Story.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:29 AM |
allies.pdf |
PDF Document |
592.7 KB |
Oct 2 2012 12:33 AM |
A Look Back at Revisionism.htm |
HTML File |
116 KB |
Oct 2 2012 12:27 AM |
Alpin MacLaren - 2006-01-06 - Cold Turkey - Multiracialism is destroying our schools.htm |
HTML File |
21.8 KB |
Oct 2 2012 12:27 AM |
Alpin MacLaren - 2006-02-09 - Civil Wrongs.htm |
HTML File |
21.6 KB |
Oct 2 2012 12:31 AM |
Alpin MacLaren - 2006-03-02 - When Logic Fails.htm |
HTML File |
8.9 KB |
Oct 2 2012 12:31 AM |
A Man Named Arkan.htm |
HTML File |
8.8 KB |
Oct 2 2012 12:30 AM |
AMAZING ISSUE WITH TARGET.TXT |
Text File |
1.9 KB |
Oct 2 2012 12:28 AM |
America's Middle Class Shrinking in Globalist Economy.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:31 AM |
America's Most Powerful Hate Group.htm |
HTML File |
14.3 KB |
Oct 2 2012 12:31 AM |
America Disappearing.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:28 AM |
America Firster Jew Exposes Israel and the Zionist Network.htm |
HTML File |
87.4 KB |
Oct 2 2012 12:34 AM |
American Literature Sequence.pdf |
PDF Document |
481.6 KB |
Oct 2 2012 12:28 AM |
Americans Say Enough is Enough! Miller Beer Boycott Update.htm |
HTML File |
10.1 KB |
Oct 2 2012 12:28 AM |
american_haters2.pdf |
PDF Document |
704.2 KB |
Oct 2 2012 12:34 AM |
Amerika Text Uploads.sit |
SIT Archive |
488.7 KB |
Oct 2 2012 12:33 AM |
Amid Katrina Chaos, Congressman Used National Guard to Visit Home.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:33 AM |
A Mile Too Far.htm |
HTML File |
26.5 KB |
Oct 2 2012 12:33 AM |
A Minuteman Boosts Border Overhaul Reform.htm |
HTML File |
4.7 KB |
Oct 2 2012 12:30 AM |
amusing_bible.zip |
ZIP Archive |
365.3 KB |
Oct 2 2012 12:33 AM |
amusing_gospel.zip |
ZIP Archive |
341.2 KB |
Oct 2 2012 12:34 AM |
Anarcho-Tyranny—Where Multiculturalism Leads.htm |
HTML File |
7 KB |
Oct 2 2012 12:29 AM |
A National Emergency.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:28 AM |
Andrew Young Pulls a 'Mel Gibson'.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:32 AM |
A New Commission for a New Era.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:32 AM |
AnimalFarm.pdf |
PDF Document |
224.6 KB |
Oct 2 2012 12:30 AM |
AnneFrankFraud.pdf |
PDF Document |
111.4 KB |
Oct 2 2012 12:31 AM |
Another Anti-White Race-Hate Murder Ignored by National Media.htm |
HTML File |
6.2 KB |
Oct 2 2012 12:28 AM |
Anti-Child-Molester Protest Stopped by 'Anti-Fascist Action'.htm |
HTML File |
3 KB |
Oct 2 2012 12:27 AM |
Anti-White Discrimination Plagues European Art Scene.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:33 AM |
Anti-White Hate Crimes.rtf |
RTF File |
18.1 KB |
Oct 2 2012 12:30 AM |
Anti-White Quotes.txt |
Text File |
12.1 KB |
Oct 2 2012 12:28 AM |
antichrist.htm |
HTML File |
198 KB |
Oct 2 2012 12:33 AM |
AntiHumans.pdf |
PDF Document |
599.7 KB |
Oct 2 2012 12:31 AM |
antiracism.htm |
HTML File |
47.7 KB |
Oct 2 2012 12:33 AM |
antisemitismcauses.pdf |
PDF Document |
990.6 KB |
Oct 2 2012 12:29 AM |
antisemitismcauses.rtf |
RTF File |
547.7 KB |
Oct 2 2012 12:34 AM |
A Once Great Britain.htm |
HTML File |
7.2 KB |
Oct 2 2012 12:30 AM |
AP.pdf |
PDF Document |
201.3 KB |
Oct 2 2012 12:29 AM |
AP.rtf |
RTF File |
246.9 KB |
Oct 2 2012 12:31 AM |
Apartheid State of Israel Expands Colonization of Golan Heights.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:27 AM |
AP In Hurricane 'Moral Equivalency' Hassle.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:28 AM |
AP Interviews Geert Wilders.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:33 AM |
Apocalypse at Dresden - The Worst Massacre in the History of the World.htm |
HTML File |
38.9 KB |
Oct 2 2012 12:32 AM |
apology.htm |
HTML File |
14.2 KB |
Oct 2 2012 12:28 AM |
Apparent Drug Overdose Claims Life of National Vanguard Foe.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:34 AM |
application.pdf |
PDF Document |
396 KB |
Oct 2 2012 12:31 AM |
Apr01.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:33 AM |
Apr02.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:28 AM |
Apr03.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:29 AM |
Apr04.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:32 AM |
Apr05-1.pdf |
PDF Document |
636.9 KB |
Oct 2 2012 12:33 AM |
April 30, 1863 - The Battle of Camarón.htm |
HTML File |
8.9 KB |
Oct 2 2012 12:31 AM |
Ar-fly.pdf |
PDF Document |
114.3 KB |
Oct 2 2012 12:34 AM |
AR2006041001423_pf.html |
HTML File |
11.7 KB |
Oct 2 2012 12:33 AM |
AR2006041200149.html |
HTML File |
67.1 KB |
Oct 2 2012 12:31 AM |
AR2006041200477.html |
HTML File |
71.6 KB |
Oct 2 2012 12:33 AM |
Arabs and Slave Trade.htm |
HTML File |
11.5 KB |
Oct 2 2012 12:28 AM |
arabtransfer.pdf |
PDF Document |
2.1 MB |
Oct 2 2012 12:30 AM |
arabtransfer.rtf |
RTF File |
1.6 MB |
Oct 2 2012 12:31 AM |
AreJewsARace.pdf |
PDF Document |
463.8 KB |
Oct 2 2012 12:31 AM |
A review of La convergence des catastrophes by Guillaume Corvus.htm |
HTML File |
46.7 KB |
Oct 2 2012 12:30 AM |
areyouawhiteman.pdf |
PDF Document |
62.4 KB |
Oct 2 2012 12:33 AM |
Arm Against 'Katricians,' Gun Dealers Tell Houston.htm |
HTML File |
53.3 KB |
Oct 2 2012 12:31 AM |
ArmingAmericaFraud.pdf |
PDF Document |
27.5 KB |
Oct 2 2012 12:27 AM |
Artful Anecdotes.htm |
HTML File |
7.1 KB |
Oct 2 2012 12:28 AM |
article7545.htm |
HTML File |
14 KB |
Oct 2 2012 12:33 AM |
asgard-pdf.zip |
ZIP Archive |
822.6 KB |
Oct 2 2012 12:32 AM |
Asians Murder British Lad for Being White.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:28 AM |
A Split In the Racist Right.htm |
HTML File |
21.4 KB |
Oct 2 2012 12:32 AM |
Assassination Attempt on David Duke.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:29 AM |
Assault Arrest Followed Word to Cheney.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:33 AM |
A theory of Einstein the irrational plagiarist.htm |
HTML File |
40.4 KB |
Oct 2 2012 12:31 AM |
At Least 5 Killed By Police In New Orleans (Bad Guys Killed-Not Contractors).htm |
HTML File |
63.1 KB |
Oct 2 2012 12:31 AM |
audio.html |
HTML File |
57.6 KB |
Oct 2 2012 12:30 AM |
audiovideo2.htm |
HTML File |
32.6 KB |
Oct 2 2012 12:29 AM |
Aug01.pdf |
PDF Document |
655.8 KB |
Oct 2 2012 12:28 AM |
Aug02.pdf |
PDF Document |
1.7 MB |
Oct 2 2012 12:30 AM |
Aug03.pdf |
PDF Document |
611.7 KB |
Oct 2 2012 12:31 AM |
Aug04.pdf |
PDF Document |
671.5 KB |
Oct 2 2012 12:31 AM |
August 23, 1917 - Black Mutiny Leaves 16 Whites Dead.htm |
HTML File |
5.4 KB |
Oct 2 2012 12:27 AM |
auschwitzbunkers.pdf |
PDF Document |
6.2 MB |
Oct 2 2012 12:33 AM |
auschwitzplainfacts.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:29 AM |
auschwitzplainfacts.rtf |
RTF File |
2.1 MB |
Oct 2 2012 12:33 AM |
AussieNationalism.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:31 AM |
Australia - Rape Gangs and Multiracialism.htm |
HTML File |
11.3 KB |
Oct 2 2012 12:33 AM |
Austrian court confirms British historian guilty of Holocaust denial.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:33 AM |
Austrians Fed Up With Kosher Arnie.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:32 AM |
Autumnal Equinox Comes.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:33 AM |
A V-Reader Gives Belgians a Message.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:28 AM |
av.html |
HTML File |
56.5 KB |
Oct 2 2012 12:27 AM |
AvoidAIDS.pdf |
PDF Document |
260.9 KB |
Oct 2 2012 12:28 AM |
Avoid Mestizos - AIDS Rampant Among Mestizos.htm |
HTML File |
2 KB |
Oct 2 2012 12:33 AM |
A White College Student's Guide to Political Activism.htm |
HTML File |
29.6 KB |
Oct 2 2012 12:27 AM |
A White Future is Coming - an interview with Bob Whitaker.htm |
HTML File |
26.5 KB |
Oct 2 2012 12:30 AM |
A White Majority For New Orleans.htm |
HTML File |
4 KB |
Oct 2 2012 12:31 AM |
awmso.rtf |
RTF File |
568.4 KB |
Oct 2 2012 12:33 AM |
awmso.zip |
ZIP Archive |
453.9 KB |
Oct 2 2012 12:32 AM |
Axe Wielding Albanian Mob Brutally Assaults Elderly Serb Couple in Kosovo.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:30 AM |
Aztecs Butchered, Ate Prisoners.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:27 AM |
B&H Field Manual.pdf |
PDF Document |
301.1 KB |
Oct 2 2012 12:31 AM |
Background on the Jewish Defense Organization.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:33 AM |
Back to...Homeschool.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:27 AM |
Ban-Crazy Brits Nix St. George Again.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:33 AM |
baraktriestoresolveplanedispute.html |
HTML File |
5.8 KB |
Oct 2 2012 12:33 AM |
barriers.pdf |
PDF Document |
245.7 KB |
Oct 2 2012 12:34 AM |
Baton Rouge Whites Mob Gun Stores.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:32 AM |
BBC To Report On London Kabbalah Center.htm |
HTML File |
13.1 KB |
Oct 2 2012 12:30 AM |
BeastAsSaint.pdf |
PDF Document |
135.8 KB |
Oct 2 2012 12:30 AM |
BeastAsSaintNew.pdf |
PDF Document |
76.8 KB |
Oct 2 2012 12:33 AM |
Beauty, Art, and Race.htm |
HTML File |
20.1 KB |
Oct 2 2012 12:31 AM |
Behind the Mask of Respectability - The truth about the Anti-Defamation League of B'nai B'rith.htm |
HTML File |
14.3 KB |
Oct 2 2012 12:29 AM |
Belgian Police Raid Revisionists.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:30 AM |
Belgium - Multicultural Fascism Now Official Policy.htm |
HTML File |
6.4 KB |
Oct 2 2012 12:29 AM |
Beloved Wagnerian Soprano Passes.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:34 AM |
belzec.pdf |
PDF Document |
3 MB |
Oct 2 2012 12:28 AM |
Benedict Meets with Dissident Journalist.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:31 AM |
Benedict to Meet with Traditionalists.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:28 AM |
bengurionscandals.pdf |
PDF Document |
513.6 KB |
Oct 2 2012 12:31 AM |
bengurionscandals.rtf |
RTF File |
680.9 KB |
Oct 2 2012 12:32 AM |
Bergen's Lie.htm |
HTML File |
3 KB |
Oct 2 2012 12:33 AM |
beria.pdf |
PDF Document |
318.4 KB |
Oct 2 2012 12:28 AM |
Between the Jews and the Gentiles -- In the Aggadah, the Kabbalah, and in Jewish Thought.htm |
HTML File |
61.1 KB |
Oct 2 2012 12:33 AM |
Bevier Pamphlet JR.pdf |
PDF Document |
207.9 KB |
Oct 2 2012 12:31 AM |
Bevier_pamphlet.doc |
Microsoft Word Document |
176.5 KB |
Oct 2 2012 12:32 AM |
Beyonce - 'I Make Black Records'.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:32 AM |
Beyond Chutzpah.htm |
HTML File |
32.3 KB |
Oct 2 2012 12:33 AM |
BibleTalmudQuotes.pdf |
PDF Document |
106.6 KB |
Oct 2 2012 12:33 AM |
biblography.html |
HTML File |
8.2 KB |
Oct 2 2012 12:28 AM |
Bill White - 2006-03-27 - National Socialism And The Klan.txt |
Text File |
18.6 KB |
Oct 2 2012 12:33 AM |
binLadenInterview.pdf |
PDF Document |
79.4 KB |
Oct 2 2012 12:27 AM |
biohazard.pdf |
PDF Document |
284.7 KB |
Oct 2 2012 12:33 AM |
biologicaljew.pdf |
PDF Document |
244.9 KB |
Oct 2 2012 12:31 AM |
biologicaljew.rtf |
RTF File |
324.7 KB |
Oct 2 2012 12:33 AM |
Birmingham Riots - Color is Only Skin Deep.htm |
HTML File |
4 KB |
Oct 2 2012 12:31 AM |
bks.bin |
BIN File |
10.3 KB |
Oct 2 2012 12:29 AM |
Black 'Jews' Accused in Israeli Welfare Scam.htm |
HTML File |
6.3 KB |
Oct 2 2012 12:29 AM |
blackamericaatwar.html |
HTML File |
3.5 KB |
Oct 2 2012 12:32 AM |
blackboxvoting.pdf |
PDF Document |
971.7 KB |
Oct 2 2012 12:28 AM |
Black Columnis - National Alliance Put Issue of Interracial Sex 'Out There'.htm |
HTML File |
1.7 KB |
Oct 2 2012 12:31 AM |
blackcrime.pdf |
PDF Document |
408.8 KB |
Oct 2 2012 12:32 AM |
Black Ex-Crack Salesman to Launch 'Books'.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:33 AM |
Black God Begs Devil for Dignified Demise.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:31 AM |
Black HUD Chief Foresees a 'Whiter' New Orleans.htm |
HTML File |
4 KB |
Oct 2 2012 12:29 AM |
BlackInnovation.pdf |
PDF Document |
15.3 KB |
Oct 2 2012 12:27 AM |
Black Leaders and the Demise of the OIC.htm |
HTML File |
15.1 KB |
Oct 2 2012 12:30 AM |
Black Muslim Update - Oakland Store Arab Kidnapped.htm |
HTML File |
5.6 KB |
Oct 2 2012 12:32 AM |
Blackness Tells It Like It Be.htm |
HTML File |
5 KB |
Oct 2 2012 12:28 AM |
Black Panther Foundation Seeks to Sell 'Burn Baby Burn' Hot Sauce.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:32 AM |
Black Panthers Jailed in Cop-Killing Probe.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:34 AM |
blackpupilslagdespiteeconomicstatus.html |
HTML File |
6.6 KB |
Oct 2 2012 12:28 AM |
blackpupilslosingoutindrivetoraisestandards.html |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
Black Rap Star Caught Using Sweat Shop Slaves.htm |
HTML File |
1.7 KB |
Oct 2 2012 12:31 AM |
Black Refugee Accused of Raping Retarded Girl.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:30 AM |
blackscanthackcollegeegalitariansbaffled.html |
HTML File |
12.8 KB |
Oct 2 2012 12:31 AM |
blackscommit90percentofinterracialcrime.html |
HTML File |
10 KB |
Oct 2 2012 12:30 AM |
BlackSlaveOwners.pdf |
PDF Document |
22 KB |
Oct 2 2012 12:31 AM |
BlackSlaveOwners.rtf |
RTF File |
33.4 KB |
Oct 2 2012 12:31 AM |
Blacks on New Orleans Looting Rampage.htm |
HTML File |
5.3 KB |
Oct 2 2012 12:28 AM |
Black Supremacist Relies on White Science to Stay Alive.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:32 AM |
blackswontgofarinparalleluniverse.html |
HTML File |
4.2 KB |
Oct 2 2012 12:31 AM |
Black US Employees Accused of Slave-driving in Africa.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:33 AM |
Black Vikings Fumble 'Ethics'.htm |
HTML File |
7.4 KB |
Oct 2 2012 12:32 AM |
blackyouthcultureblamedaspupilsfail.html |
HTML File |
5.8 KB |
Oct 2 2012 12:28 AM |
black_history_month_1.pdf |
PDF Document |
731.4 KB |
Oct 2 2012 12:31 AM |
blfs-book-6.1.pdf |
PDF Document |
3.2 MB |
Oct 2 2012 12:30 AM |
Bloggers_Handbook2.pdf |
PDF Document |
3.5 MB |
Oct 2 2012 12:28 AM |
Blood on the Frost - Never Forget the Hmong Massacre.htm |
HTML File |
23.3 KB |
Oct 2 2012 12:30 AM |
BNP's Griffin - Asians Engage in Ethnic Cleansing in Oldham.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:28 AM |
BNP Gets Voice on Yorkshire Race Council.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:30 AM |
BNP Leader Affirms - Islam 'Wicked' Faith.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:31 AM |
bolshevism.jpg |
JPEG Image |
17.8 KB |
Oct 2 2012 12:27 AM |
Bombs and Hurricanes - Our Struggle.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:31 AM |
books-immigration.html |
HTML File |
184 KB |
Oct 2 2012 12:28 AM |
book_of_dead.zip |
ZIP Archive |
1.1 MB |
Oct 2 2012 12:33 AM |
boredoftherings.pdf |
PDF Document |
230.4 KB |
Oct 2 2012 12:31 AM |
boredoftherings.rtf |
RTF File |
332.4 KB |
Oct 2 2012 12:31 AM |
born_to_kill.jpg |
JPEG Image |
13.1 KB |
Oct 2 2012 12:31 AM |
Boycott Miller for Supporting Illegal Aliens and Illegal Immigration.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:32 AM |
boycott_hd.pdf |
PDF Document |
860.7 KB |
Oct 2 2012 12:29 AM |
Brann - THE BUCK NEGRO.htm |
HTML File |
13.3 KB |
Oct 2 2012 12:27 AM |
brann.pdf |
PDF Document |
67.4 KB |
Oct 2 2012 12:31 AM |
breaking point.pdf |
PDF Document |
97.6 KB |
Oct 2 2012 12:28 AM |
brenner02192003.html |
HTML File |
22.7 KB |
Oct 2 2012 12:32 AM |
Brigham Young's Speech on Slavery, blacks and the Priesthood.htm |
HTML File |
17.2 KB |
Oct 2 2012 12:33 AM |
bringingdemocracytohaiti.html |
HTML File |
27.3 KB |
Oct 2 2012 12:32 AM |
Britain Recruited Muslim Terrorists.htm |
HTML File |
3 KB |
Oct 2 2012 12:27 AM |
Britain’s Racial Diversity Brings Murder; No Justice.htm |
HTML File |
3 KB |
Oct 2 2012 12:28 AM |
Britons Pay Price for Neo-Con Madness.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:27 AM |
Briton tells of Katrina nightmare.htm |
HTML File |
6.4 KB |
Oct 2 2012 12:29 AM |
brochure.pdf |
PDF Document |
1.9 MB |
Oct 2 2012 12:31 AM |
Brooklyn-Based Jew Admits to Trafficking in Women.htm |
HTML File |
4 KB |
Oct 2 2012 12:32 AM |
Brooklyn - Black 'Students' Charged With Anti-White Race Attack.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:28 AM |
Brooklyn Jew Ritually Murders Chickens.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:33 AM |
BruderFlyer.pdf |
PDF Document |
91.3 KB |
Oct 2 2012 12:30 AM |
BugChasers.pdf |
PDF Document |
58.4 KB |
Oct 2 2012 12:32 AM |
Bush - It's All About the Spin.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:31 AM |
Bush Buddy in Flap over Jewish 'Holy Water'.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
bushpoint2.jpg |
JPEG Image |
7.3 KB |
Oct 2 2012 12:31 AM |
Bush Speech Gave Race Hustlers Fresh Ammo.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
bush_911_2005.pdf |
PDF Document |
218.7 KB |
Oct 2 2012 12:30 AM |
bwbw.pdf |
PDF Document |
990.5 KB |
Oct 2 2012 12:33 AM |
By Way Of Deception.htm |
HTML File |
29.2 KB |
Oct 2 2012 12:29 AM |
By way of deception thou shalt do war.htm |
HTML File |
39.1 KB |
Oct 2 2012 12:30 AM |
California - April Gaede Awarded Queen Isabella Prize.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:34 AM |
California - Minuteman Won Election Day Vote.htm |
HTML File |
7 KB |
Oct 2 2012 12:31 AM |
California - Pro-White Music At Folk The System.htm |
HTML File |
10.4 KB |
Oct 2 2012 12:29 AM |
California - Tookie's Son on the Run.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:33 AM |
California - Tookie Executed.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:32 AM |
California Initiative for State Border Police Gaining Ground.htm |
HTML File |
4.7 KB |
Oct 2 2012 12:32 AM |
Camp of the Saints.pdf |
PDF Document |
18.1 KB |
Oct 2 2012 12:28 AM |
Can 'Liberals' Be Educated.htm |
HTML File |
45.2 KB |
Oct 2 2012 12:33 AM |
Canadian Heritage Alliance Articles Letters to Newspapers .doc |
Microsoft Word Document |
22.5 KB |
Oct 2 2012 12:30 AM |
Cannibalism in the African Congo.htm |
HTML File |
12.9 KB |
Oct 2 2012 12:33 AM |
Cans of Paint, Two White Halves, and Chromosomes.htm |
HTML File |
9.4 KB |
Oct 2 2012 12:31 AM |
carplans.zip |
ZIP Archive |
217.7 KB |
Oct 2 2012 12:32 AM |
CarrsTestimony.pdf |
PDF Document |
121.1 KB |
Oct 2 2012 12:34 AM |
CarrsTestimony.rtf |
RTF File |
238.1 KB |
Oct 2 2012 12:29 AM |
catalog.pdf |
PDF Document |
511.1 KB |
Oct 2 2012 12:29 AM |
catalog_pdf0607.htm |
HTML File |
7.4 KB |
Oct 2 2012 12:31 AM |
Catastrophe In Kansas City.htm |
HTML File |
34.6 KB |
Oct 2 2012 12:34 AM |
Catholic Leaders Condemn Anti-Zionism.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
CattleRaidOfCooley.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:33 AM |
ccm.pdf |
PDF Document |
9.1 MB |
Oct 2 2012 12:31 AM |
ccm.zip |
ZIP Archive |
3 MB |
Oct 2 2012 12:33 AM |
ccs.pdf |
PDF Document |
8.3 MB |
Oct 2 2012 12:31 AM |
cgc 1.pdf |
PDF Document |
2.4 MB |
Oct 2 2012 12:33 AM |
cgc2.pdf |
PDF Document |
2.9 MB |
Oct 2 2012 12:30 AM |
cgc3.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:29 AM |
Challenging the Power of the Jewish Lobby - What Should Be Done.htm |
HTML File |
22.2 KB |
Oct 2 2012 12:33 AM |
Challenging the Power of the Jewish Lobby.htm |
HTML File |
6.6 KB |
Oct 2 2012 12:30 AM |
chapter01.html |
HTML File |
4 KB |
Oct 2 2012 12:32 AM |
chapter02.html |
HTML File |
8 KB |
Oct 2 2012 12:32 AM |
chapter03.html |
HTML File |
10.6 KB |
Oct 2 2012 12:32 AM |
chapter04.html |
HTML File |
5.4 KB |
Oct 2 2012 12:30 AM |
chapter05.html |
HTML File |
5.3 KB |
Oct 2 2012 12:31 AM |
chapter06.html |
HTML File |
12.4 KB |
Oct 2 2012 12:31 AM |
chapter07.html |
HTML File |
15.1 KB |
Oct 2 2012 12:28 AM |
chapter08.html |
HTML File |
20.1 KB |
Oct 2 2012 12:32 AM |
chapter09.html |
HTML File |
4.4 KB |
Oct 2 2012 12:30 AM |
chapter10.html |
HTML File |
34.2 KB |
Oct 2 2012 12:33 AM |
chapter11.html |
HTML File |
13.6 KB |
Oct 2 2012 12:32 AM |
chapter12.html |
HTML File |
16.8 KB |
Oct 2 2012 12:28 AM |
chapter13.html |
HTML File |
12.6 KB |
Oct 2 2012 12:33 AM |
chapter14.html |
HTML File |
8.5 KB |
Oct 2 2012 12:33 AM |
chapter15.html |
HTML File |
20.8 KB |
Oct 2 2012 12:31 AM |
chapter16.html |
HTML File |
7.3 KB |
Oct 2 2012 12:30 AM |
chapter17.html |
HTML File |
8.2 KB |
Oct 2 2012 12:32 AM |
chapter18.html |
HTML File |
6.1 KB |
Oct 2 2012 12:29 AM |
chapter19.html |
HTML File |
10 KB |
Oct 2 2012 12:33 AM |
chapter20.html |
HTML File |
6.5 KB |
Oct 2 2012 12:29 AM |
Chapt_01.htm |
HTML File |
14.4 KB |
Oct 2 2012 12:31 AM |
Chapt_02.htm |
HTML File |
31.7 KB |
Oct 2 2012 12:33 AM |
Chapt_03.htm |
HTML File |
28.1 KB |
Oct 2 2012 12:31 AM |
Chapt_04.htm |
HTML File |
30.8 KB |
Oct 2 2012 12:31 AM |
Chapt_05.htm |
HTML File |
18.2 KB |
Oct 2 2012 12:33 AM |
Chapt_06.htm |
HTML File |
62.9 KB |
Oct 2 2012 12:33 AM |
Chapt_07.htm |
HTML File |
43.2 KB |
Oct 2 2012 12:33 AM |
Chapt_08.htm |
HTML File |
19.3 KB |
Oct 2 2012 12:31 AM |
Chapt_09.htm |
HTML File |
45.7 KB |
Oct 2 2012 12:30 AM |
Chapt_10.htm |
HTML File |
40.8 KB |
Oct 2 2012 12:27 AM |
Chapt_11.htm |
HTML File |
22.5 KB |
Oct 2 2012 12:28 AM |
Chapt_12.htm |
HTML File |
27.5 KB |
Oct 2 2012 12:31 AM |
Chapt_13.htm |
HTML File |
31.5 KB |
Oct 2 2012 12:27 AM |
Chapt_14.htm |
HTML File |
36.1 KB |
Oct 2 2012 12:31 AM |
Chapt_15.htm |
HTML File |
18.8 KB |
Oct 2 2012 12:33 AM |
Chapt_16.htm |
HTML File |
7.8 KB |
Oct 2 2012 12:28 AM |
Chavez Condemned for 'Anti-Semitism'.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:32 AM |
Cherishing an Older Catholicism.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:32 AM |
Chertoff Aide Guilty in Child Porn Case.htm |
HTML File |
5.2 KB |
Oct 2 2012 12:31 AM |
Chertoff Claims He Didn't Have A Clue.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:30 AM |
Chertoff Proposes Non-Profit Spying Group.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:33 AM |
Chertoff Timeline.htm |
HTML File |
10.1 KB |
Oct 2 2012 12:30 AM |
chickenhawks.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:34 AM |
Children - National Treasure or Personal Luxury Item.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:29 AM |
China, Deflation And The Dollar.htm |
HTML File |
32.6 KB |
Oct 2 2012 12:27 AM |
chinacautionsisraelagainstsellingawacstoindia.html |
HTML File |
3.5 KB |
Oct 2 2012 12:31 AM |
chinadeploysdronesfromisrael.html |
HTML File |
6.9 KB |
Oct 2 2012 12:34 AM |
chinapreparesforwaragainsttheunitedstates.html |
HTML File |
4.5 KB |
Oct 2 2012 12:30 AM |
China Replaces U.S. As World's Largest Exporter.htm |
HTML File |
6.4 KB |
Oct 2 2012 12:31 AM |
chinasarsenalborninamerica.html |
HTML File |
9 KB |
Oct 2 2012 12:28 AM |
ChinaStealsUSMilitarySecrets.pdf |
PDF Document |
639.7 KB |
Oct 2 2012 12:28 AM |
chinesespyingandthewhitehouse.html |
HTML File |
12.1 KB |
Oct 2 2012 12:32 AM |
Chosen for Pornography.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:27 AM |
Christian Colleges Offer Free Tuition to Katrina Refugees.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:28 AM |
Christian Leaders Urge Third World Flood.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:30 AM |
Christians in Jerusalem Want Jews to Stop Spitting on Them.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:30 AM |
Church asks evacuee to leave.htm |
HTML File |
9.3 KB |
Oct 2 2012 12:30 AM |
Church fighting IRS over anti-war sermon won't give up documents.htm |
HTML File |
8.6 KB |
Oct 2 2012 12:28 AM |
churchillswar1.pdf |
PDF Document |
5.8 MB |
Oct 2 2012 12:32 AM |
churchillswar2.pdf |
PDF Document |
5.1 MB |
Oct 2 2012 12:31 AM |
Chutzpah - Zionists Running Anti-Slavery Organization.htm |
HTML File |
13.2 KB |
Oct 2 2012 12:28 AM |
ci.zip |
ZIP Archive |
908.9 KB |
Oct 2 2012 12:31 AM |
CISReport.pdf |
PDF Document |
220.7 KB |
Oct 2 2012 12:30 AM |
CitizensInformerWinter2005 - Small.pdf |
PDF Document |
2.6 MB |
Oct 2 2012 12:31 AM |
CivilDisobedience.pdf |
PDF Document |
87.8 KB |
Oct 2 2012 12:31 AM |
Civil War in Europe.htm |
HTML File |
5.4 KB |
Oct 2 2012 12:31 AM |
CLARITY.pdf |
PDF Document |
87.6 KB |
Oct 2 2012 12:31 AM |
classical_iq_r2.cgi.htm |
HTML File |
23.6 KB |
Oct 2 2012 12:33 AM |
clinton.pdf |
PDF Document |
72 KB |
Oct 2 2012 12:31 AM |
cofc.pdf |
PDF Document |
1.9 MB |
Oct 2 2012 12:29 AM |
CofCCguide.pdf |
PDF Document |
49.2 KB |
Oct 2 2012 12:30 AM |
collective_punishment.pdf |
PDF Document |
218 KB |
Oct 2 2012 12:33 AM |
color-brochure.pdf |
PDF Document |
571.5 KB |
Oct 2 2012 12:33 AM |
color2.html |
HTML File |
8.7 KB |
Oct 2 2012 12:29 AM |
Colorado - 57 Refugees Have Felony Records.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:33 AM |
COLOR COMMUNISM AND COMMON SENSE.txt |
Text File |
74.7 KB |
Oct 2 2012 12:34 AM |
colorcrime99.pdf |
PDF Document |
399.6 KB |
Oct 2 2012 12:29 AM |
ColorOfCrime.pdf |
PDF Document |
408.4 KB |
Oct 2 2012 12:31 AM |
come-and-hear-complete.zip |
ZIP Archive |
58.3 MB |
Oct 2 2012 12:28 AM |
coming_soon.pdf |
PDF Document |
479.4 KB |
Oct 2 2012 12:33 AM |
communist.html |
HTML File |
44.3 KB |
Oct 2 2012 12:32 AM |
comm_1.html |
HTML File |
48.2 KB |
Oct 2 2012 12:33 AM |
CompilationPresentation.pdf |
PDF Document |
6.3 MB |
Oct 2 2012 12:27 AM |
complaintform_advertising.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:30 AM |
complaintform_bank.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:33 AM |
complaintform_banquet_service.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:33 AM |
complaintform_barber_shop.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:28 AM |
complaintform_beauty_parlor.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:28 AM |
complaintform_church.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:33 AM |
complaintform_department_store.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:30 AM |
complaintform_ethnic_answering_service.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:28 AM |
complaintform_hair_salon.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:31 AM |
complaintform_hospital.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:32 AM |
complaintform_hotel.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:31 AM |
complaintform_motel.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:32 AM |
complaintform_movie_race_mixing.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:33 AM |
complaintform_news_show.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:34 AM |
complaintform_physician_office.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:33 AM |
complaintform_restaurant.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:33 AM |
complaintform_school.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:32 AM |
complaintform_service_station.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:33 AM |
complaintform_store.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:30 AM |
complaintform_theatre.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:27 AM |
CompleteGuide.html |
HTML File |
94.4 KB |
Oct 2 2012 12:33 AM |
Confirmed - Snipers Black.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:32 AM |
Congressional Black Caucus Holds Press Conference.htm |
HTML File |
5.3 KB |
Oct 2 2012 12:33 AM |
Congressman Apologizes, Denies Assaulting Mistress.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:31 AM |
Conservatives; They Refuse to Call It What It Really Is - Genocide.htm |
HTML File |
19.4 KB |
Oct 2 2012 12:30 AM |
Contemporary Trotskyism.htm |
HTML File |
14.4 KB |
Oct 2 2012 12:31 AM |
Controlled Media - Forget the Facts About Katrina.htm |
HTML File |
8.6 KB |
Oct 2 2012 12:28 AM |
ControversyOfZion.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:31 AM |
convoypq17.pdf |
PDF Document |
2.5 MB |
Oct 2 2012 12:30 AM |
Corrupting Our Police.htm |
HTML File |
19.9 KB |
Oct 2 2012 12:28 AM |
cosmoe.pdf |
PDF Document |
171.7 KB |
Oct 2 2012 12:31 AM |
cosmosymbol.pdf |
PDF Document |
59.7 KB |
Oct 2 2012 12:28 AM |
Cosmotheism.pdf |
PDF Document |
194.5 KB |
Oct 2 2012 12:30 AM |
Cosmotheism.rtf |
RTF File |
63.8 KB |
Oct 2 2012 12:31 AM |
CostOfIsraelToUS.pdf |
PDF Document |
25.6 KB |
Oct 2 2012 12:33 AM |
CostOfUSMideastPolicy.pdf |
PDF Document |
96.4 KB |
Oct 2 2012 12:34 AM |
Court Temporarily OKs Domestic Spying.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:28 AM |
Court to Tookie - No Thanks, Snitch.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:33 AM |
Covering the 'Kwa - The Inflexible, Utterly Predictable and Parody-Worthy Coverage of Race by the PressWrightCovertheKwa - 11-2005.htm |
HTML File |
12.1 KB |
Oct 2 2012 12:29 AM |
coxreportisarealwhodunit.html |
HTML File |
5.9 KB |
Oct 2 2012 12:31 AM |
Cre88or.ttf |
TTF File |
228 KB |
Oct 2 2012 12:31 AM |
Creamatorium4.pdf |
PDF Document |
70.7 KB |
Oct 2 2012 12:33 AM |
Creaoor - index.html |
HTML File |
2 KB |
Oct 2 2012 12:29 AM |
Creationism and Truth.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:31 AM |
creativity.html |
HTML File |
20.9 KB |
Oct 2 2012 12:32 AM |
Crime Cover-Up in DC.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:34 AM |
CrimeOfOurAge.pdf |
PDF Document |
206.8 KB |
Oct 2 2012 12:30 AM |
Criticism is Not Hate.htm |
HTML File |
9.4 KB |
Oct 2 2012 12:27 AM |
CultureOfCritique.pdf |
PDF Document |
1.9 MB |
Oct 2 2012 12:28 AM |
Curt Maynard - 2006-07-02 - A Frank Discussion of Jewish Group Dynamics.htm |
HTML File |
48.4 KB |
Oct 2 2012 12:31 AM |
Czech Gets Expensive Lesson.htm |
HTML File |
8.6 KB |
Oct 2 2012 12:28 AM |
d2presid.html |
HTML File |
5.2 KB |
Oct 2 2012 12:30 AM |
Daddy_English.pdf |
PDF Document |
413.6 KB |
Oct 2 2012 12:31 AM |
Dallas Cops Nix Katrina Officers.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:27 AM |
Dan Osterton - 2006-07-20 - The Necessity of Invasion.htm |
HTML File |
10.3 KB |
Oct 2 2012 12:31 AM |
dare.pdf |
PDF Document |
348.5 KB |
Oct 2 2012 12:31 AM |
Daryl Bradford Smith - Prepare for the upcoming battle.htm |
HTML File |
20.9 KB |
Oct 2 2012 12:29 AM |
David C Tate - The Cause.pdf |
PDF Document |
166 KB |
Oct 2 2012 12:32 AM |
David Daogherty - 2004-11-12 - The Little-Known World of Pro-White Music.txt |
Text File |
17.1 KB |
Oct 2 2012 12:30 AM |
David Daugherty - 2006-02-09 - Thanks, We Have Our Own Media Now.htm |
HTML File |
16.7 KB |
Oct 2 2012 12:30 AM |
David Duke Discusses Jewish Conspiracy On MSNBC.txt |
Text File |
17.3 KB |
Oct 2 2012 12:33 AM |
David Irving - 1967.pdf |
PDF Document |
937.3 KB |
Oct 2 2012 12:27 AM |
David Irving - Apocalypse.zip |
ZIP Archive |
1.4 MB |
Oct 2 2012 12:28 AM |
David Irving - Generals.zip |
ZIP Archive |
3.5 MB |
Oct 2 2012 12:30 AM |
David Irving - Goebbels.pdf |
PDF Document |
2.9 MB |
Oct 2 2012 12:33 AM |
David Irving - Goering.sit |
SIT Archive |
3.5 MB |
Oct 2 2012 12:27 AM |
David Irving - Hess.zip |
ZIP Archive |
1.8 MB |
Oct 2 2012 12:31 AM |
David Irving - HW1.pdf |
PDF Document |
3.6 MB |
Oct 2 2012 12:29 AM |
David Irving - Keitel.zip |
ZIP Archive |
1 MB |
Oct 2 2012 12:31 AM |
David Irving - MaresNest.zip |
ZIP Archive |
1 MB |
Oct 2 2012 12:34 AM |
David Irving - Milch.zip |
ZIP Archive |
2.1 MB |
Oct 2 2012 12:32 AM |
David Irving - Morell.zip |
ZIP Archive |
880.6 KB |
Oct 2 2012 12:33 AM |
David Irving - Morgenthau_Plan.zip |
ZIP Archive |
215.2 KB |
Oct 2 2012 12:32 AM |
David Irving - NUREMBERG.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:33 AM |
David Irving - Pt1.zip |
ZIP Archive |
1.6 MB |
Oct 2 2012 12:30 AM |
David Irving - Pt2.zip |
ZIP Archive |
1.7 MB |
Oct 2 2012 12:31 AM |
David Irving - Pt3.zip |
ZIP Archive |
2.1 MB |
Oct 2 2012 12:31 AM |
David Irving - Pt4.zip |
ZIP Archive |
454.3 KB |
Oct 2 2012 12:28 AM |
David Irving - ReichHoertMit.zip |
ZIP Archive |
1012.9 KB |
Oct 2 2012 12:31 AM |
David Irving - Rommel_illustr.zip |
ZIP Archive |
4.5 MB |
Oct 2 2012 12:33 AM |
David Irving - The Destruction of Convoy PQ. 17 - 1968edition |
17 - 1968EDITION File |
2.2 MB |
Oct 2 2012 12:30 AM |
David Irving - Uprising.zip |
ZIP Archive |
2 MB |
Oct 2 2012 12:31 AM |
David Irving the 'Anti-Semite'.htm |
HTML File |
5.2 KB |
Oct 2 2012 12:29 AM |
David Lane - 88 Precepts.pdf |
PDF Document |
20.5 KB |
Oct 2 2012 12:31 AM |
David Lane - Dissension in the Ranks.htm |
HTML File |
10.9 KB |
Oct 2 2012 12:27 AM |
David Lane - KD Rebel - 2004.pdf |
PDF Document |
424.8 KB |
Oct 2 2012 12:30 AM |
David Lane - Letter to the Reality Deniers - by David Lane of The Order - P.O.W.txt |
Text File |
14.2 KB |
Oct 2 2012 12:28 AM |
David_Lane - The Final Address of David Lane to the Jury.htm |
HTML File |
5.3 KB |
Oct 2 2012 12:28 AM |
DealingInHate.pdf |
PDF Document |
191.8 KB |
Oct 2 2012 12:30 AM |
Dealing With the Peak Oil Critics.htm |
HTML File |
25.8 KB |
Oct 2 2012 12:32 AM |
Debating the Lobby.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:33 AM |
DebunkingGenocideMyth.pdf |
PDF Document |
771.8 KB |
Oct 2 2012 12:30 AM |
Dec01.pdf |
PDF Document |
1011.5 KB |
Oct 2 2012 12:27 AM |
Dec02.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:28 AM |
Dec03.pdf |
PDF Document |
869.2 KB |
Oct 2 2012 12:31 AM |
Dec04.pdf |
PDF Document |
905.8 KB |
Oct 2 2012 12:28 AM |
DeclineOfWest.pdf |
PDF Document |
421.9 KB |
Oct 2 2012 12:33 AM |
Deejay - 'I'm Coming for Your Seed'.htm |
HTML File |
27.8 KB |
Oct 2 2012 12:31 AM |
Deejay’s Appeal - ‘Kill the Whiteness Inside’.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:31 AM |
Defense Firms Making a Killing on Iraq War.htm |
HTML File |
3 KB |
Oct 2 2012 12:30 AM |
Defensible Racism.htm |
HTML File |
11.7 KB |
Oct 2 2012 12:33 AM |
Deir Yassin 1947,.html |
HTML File |
1.3 KB |
Oct 2 2012 12:29 AM |
DemocracyInAmerica.pdf |
PDF Document |
6.7 MB |
Oct 2 2012 12:28 AM |
Democrats Condemn Chertoff's Incompetence.htm |
HTML File |
4 KB |
Oct 2 2012 12:31 AM |
Denver National Vanguard - Supporting the Columbus Day Parade.htm |
HTML File |
4.7 KB |
Oct 2 2012 12:28 AM |
design.pdf |
PDF Document |
173.3 KB |
Oct 2 2012 12:31 AM |
Desperate Jewish News Outlets Abandoning Last Pretenses of Honesty.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:31 AM |
Detainee Paralyzed During Torture in Israeli Prison.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:31 AM |
DetNewsReprint.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:32 AM |
Devil's Advocate - The Chinese Have Guts.htm |
HTML File |
7.4 KB |
Oct 2 2012 12:33 AM |
Did Arabs Accidentally Get Canned Pork By Mistake.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:28 AM |
Did Time Magazine Lie to Pad Circulation.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
Disaster Buck Stopped at Chertoff, Not Brown.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:31 AM |
Discussing Race in a Globalized World.htm |
HTML File |
11.5 KB |
Oct 2 2012 12:33 AM |
diversity.pdf |
PDF Document |
503.4 KB |
Oct 2 2012 12:31 AM |
DiversityAtWork.pdf |
PDF Document |
76.3 KB |
Oct 2 2012 12:28 AM |
Diversity Can Only Be Countered With Brutality And War.htm |
HTML File |
46.5 KB |
Oct 2 2012 12:29 AM |
Dividing the World.htm |
HTML File |
22.4 KB |
Oct 2 2012 12:31 AM |
Do Blacks Deserve Billions for Slavery.htm |
HTML File |
11.9 KB |
Oct 2 2012 12:33 AM |
doles.pdf |
PDF Document |
61.2 KB |
Oct 2 2012 12:33 AM |
Do They Think It’s Worth It.htm |
HTML File |
12.6 KB |
Oct 2 2012 12:33 AM |
Doty_H2Price.pdf |
PDF Document |
330.3 KB |
Oct 2 2012 12:27 AM |
Do Whites Really Deserve to Exist.htm |
HTML File |
9.7 KB |
Oct 2 2012 12:32 AM |
downedchinesef8carriedisraelimissile.html |
HTML File |
2 KB |
Oct 2 2012 12:30 AM |
Dr. David Duke - My Awakening - Complete Book from SolarGeneral_com.pdf |
PDF Document |
24.9 MB |
Oct 2 2012 12:29 AM |
Dr. Lorraine Day’s Response to Judy Andreas - zionism.htm |
HTML File |
59.8 KB |
Oct 2 2012 12:33 AM |
Dr. William Pierce - The Turner Diaries.pdf |
PDF Document |
809.7 KB |
Oct 2 2012 12:29 AM |
DR Congo's atrocious secret.htm |
HTML File |
18.8 KB |
Oct 2 2012 12:27 AM |
Dreaming of a Black Christmas.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:33 AM |
Dream of inter-racial cooperation finally a UK reality.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:31 AM |
dresden.pdf |
PDF Document |
974.8 KB |
Oct 2 2012 12:28 AM |
dresden1995.pdf |
PDF Document |
763.7 KB |
Oct 2 2012 12:31 AM |
dropthelist.htm |
HTML File |
21.9 KB |
Oct 2 2012 12:32 AM |
Drug Feud Claims Life of Anti-White Activist.htm |
HTML File |
5.2 KB |
Oct 2 2012 12:33 AM |
dth.pdf |
PDF Document |
16 MB |
Oct 2 2012 12:28 AM |
dth.zip |
ZIP Archive |
6 MB |
Oct 2 2012 12:30 AM |
Dumbing Down America.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:30 AM |
DuneSeries.zip |
ZIP Archive |
7.1 MB |
Oct 2 2012 12:31 AM |
Dutch Inquisition Reborn.htm |
HTML File |
6.7 KB |
Oct 2 2012 12:34 AM |
Dutch to Become First European Nation to Ban Burka.htm |
HTML File |
2.2 KB |
Oct 2 2012 12:33 AM |
Dynohub_assembly.pdf |
PDF Document |
263.7 KB |
Oct 2 2012 12:28 AM |
EBlowback_911.pdf |
PDF Document |
7.7 MB |
Oct 2 2012 12:31 AM |
Ebonics Suggested for District.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:30 AM |
ec.pdf |
PDF Document |
906.4 KB |
Oct 2 2012 12:32 AM |
EcritsRevisionnistes.pdf |
PDF Document |
270.9 KB |
Oct 2 2012 12:33 AM |
EdictOfExpulsion.pdf |
PDF Document |
40.8 KB |
Oct 2 2012 12:31 AM |
Editing Martin Luther King, Jr.htm |
HTML File |
37.4 KB |
Oct 2 2012 12:31 AM |
Educational Sabotage.htm |
HTML File |
35 KB |
Oct 2 2012 12:31 AM |
Educators Baffled at Stubborn Achievement Gap.htm |
HTML File |
12.8 KB |
Oct 2 2012 12:32 AM |
Edward Fagan Sues Lloyd's of London, U.S. Government.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:31 AM |
Edwards.pdf |
PDF Document |
64.2 KB |
Oct 2 2012 12:31 AM |
EFBI_CIA_mob_treachery.pdf |
PDF Document |
2.7 MB |
Oct 2 2012 12:28 AM |
einstein-prioritymyth.htm |
HTML File |
21 KB |
Oct 2 2012 12:30 AM |
EinsteinConspiracy.pdf |
PDF Document |
462.9 KB |
Oct 2 2012 12:31 AM |
EinsteinHoax.pdf |
PDF Document |
3.8 MB |
Oct 2 2012 12:28 AM |
EinsteinStoleE=mc2.htm |
HTML File |
10.1 KB |
Oct 2 2012 12:31 AM |
EIraq_lies.pdf |
PDF Document |
4.1 MB |
Oct 2 2012 12:32 AM |
Eire - YOU DID IT! Now Let's Build On the Success.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:31 AM |
EisenhowersHolocaust.pdf |
PDF Document |
19.8 KB |
Oct 2 2012 12:27 AM |
Elias Lönnrot - The Kalevala - 1888.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:28 AM |
Elizabeth Smith - A Woman Looks at the Lifetime Channel.htm |
HTML File |
10.2 KB |
Oct 2 2012 12:32 AM |
Ellin Anderson - 2005-12-22 - In This Sign.txt |
Text File |
13.8 KB |
Oct 2 2012 12:31 AM |
Empowerment by Rape - the Sexual Holocaust.htm |
HTML File |
13.4 KB |
Oct 2 2012 12:31 AM |
endimmigration.pdf |
PDF Document |
91.3 KB |
Oct 2 2012 12:33 AM |
Ending the Dollar's Tyranny.htm |
HTML File |
19.4 KB |
Oct 2 2012 12:30 AM |
EndKingHolodayNew.pdf |
PDF Document |
109.4 KB |
Oct 2 2012 12:31 AM |
End of an Era - Spearhead to Close.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:31 AM |
End of the Rainbow.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:32 AM |
EndTheKingHoloday.pdf |
PDF Document |
222.5 KB |
Oct 2 2012 12:31 AM |
EnemyOfEurope.pdf |
PDF Document |
545.8 KB |
Oct 2 2012 12:33 AM |
England Prepares to Honor Millenium of First Patron Saint.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:31 AM |
English Lad 'Too Pale'.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:33 AM |
Englishman's Zimbabwean Road Trip to Texas.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:33 AM |
Enron - A Microcosm of America.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:32 AM |
en_gentiles - Gentiles in Halacha.zip |
ZIP Archive |
64.8 KB |
Oct 2 2012 12:28 AM |
en_gentiles1 - Gentiles in Halacha.zip |
ZIP Archive |
8.3 KB |
Oct 2 2012 12:32 AM |
Erik the Norseman A Nation Betrayed.doc |
Microsoft Word Document |
33.5 KB |
Oct 2 2012 12:32 AM |
Erik the Norseman An Essay on Comparative Horror.doc |
Microsoft Word Document |
28 KB |
Oct 2 2012 12:27 AM |
Erik the Norseman Boy Meets Boy - Boy Takes Boy to the Prom.doc |
Microsoft Word Document |
25 KB |
Oct 2 2012 12:33 AM |
Erik the Norseman Canada Diagnosis - CRITICAL.doc |
Microsoft Word Document |
25 KB |
Oct 2 2012 12:28 AM |
Erik the Norseman Canadian Homelessness - A White Problem.doc |
Microsoft Word Document |
30 KB |
Oct 2 2012 12:28 AM |
Erik the Norseman Canadians Can Say What They Want, Eh!.doc |
Microsoft Word Document |
24 KB |
Oct 2 2012 12:33 AM |
Erik the Norseman GOOD MORNING CANADA! Wake Up and Smell the.doc |
Microsoft Word Document |
26.5 KB |
Oct 2 2012 12:34 AM |
Erik the Norseman Iraq Proof Islam is a Nest of Vipers.doc |
Microsoft Word Document |
29.5 KB |
Oct 2 2012 12:31 AM |
Erik the Norseman Just Who Is an Aboriginal.doc |
Microsoft Word Document |
30 KB |
Oct 2 2012 12:31 AM |
Erik the Norseman Loss of Sovereignty to Globalism.doc |
Microsoft Word Document |
28.5 KB |
Oct 2 2012 12:27 AM |
Erik the Norseman Misplaced Hate.doc |
Microsoft Word Document |
26 KB |
Oct 2 2012 12:31 AM |
Erik the Norseman Paul Fromm Speaks in Vancouver Another suc.doc |
Microsoft Word Document |
28 KB |
Oct 2 2012 12:30 AM |
Erik the Norseman Promotion Anyone.doc |
Microsoft Word Document |
26.5 KB |
Oct 2 2012 12:31 AM |
Erik the Norseman Same Rights = Special Rights.doc |
Microsoft Word Document |
28 KB |
Oct 2 2012 12:28 AM |
Erik the Norseman SARS Politically Correct Disease.doc |
Microsoft Word Document |
40 KB |
Oct 2 2012 12:32 AM |
Erik the Norseman Some Dominion Day Reflections on the Benef.doc |
Microsoft Word Document |
29 KB |
Oct 2 2012 12:31 AM |
Erik the Norseman Some Thoughts of a Proud Racialist.doc |
Microsoft Word Document |
33 KB |
Oct 2 2012 12:30 AM |
Erik the Norseman Some Thoughts on Abortion.doc |
Microsoft Word Document |
29.5 KB |
Oct 2 2012 12:28 AM |
Erik the Norseman Some Thoughts on Native Land Claims.doc |
Microsoft Word Document |
33 KB |
Oct 2 2012 12:28 AM |
Erik the Norseman Some Thoughts on Privatization.doc |
Microsoft Word Document |
29 KB |
Oct 2 2012 12:33 AM |
Erik the Norseman Some Thoughts on the Future of Transportat.doc |
Microsoft Word Document |
24.5 KB |
Oct 2 2012 12:30 AM |
Erik the Norseman Some Thoughts on the Judiciary.doc |
Microsoft Word Document |
35.5 KB |
Oct 2 2012 12:31 AM |
Erik the Norseman Some Thoughts on the Prison System.doc |
Microsoft Word Document |
28.5 KB |
Oct 2 2012 12:34 AM |
Erik the Norseman The Paradox of Complimentary Medicine.doc |
Microsoft Word Document |
26 KB |
Oct 2 2012 12:28 AM |
Erik the Norseman The People's Lament.doc |
Microsoft Word Document |
58.5 KB |
Oct 2 2012 12:30 AM |
Erik the Norseman The Zahra Kazemi Debaucle Back in the News.doc |
Microsoft Word Document |
29 KB |
Oct 2 2012 12:31 AM |
Erik the Norseman What Is an Aboriginal.doc |
Microsoft Word Document |
28.5 KB |
Oct 2 2012 12:28 AM |
Erik the Norseman When is a Jew a Jew A call to White Evange.doc |
Microsoft Word Document |
25.5 KB |
Oct 2 2012 12:33 AM |
Erik the Norseman White Pride or White Guilt.doc |
Microsoft Word Document |
39.5 KB |
Oct 2 2012 12:27 AM |
Erik the Norseman Who are the Welfare Bums.doc |
Microsoft Word Document |
26.5 KB |
Oct 2 2012 12:30 AM |
Erik the Norseman Who Built Canada.doc |
Microsoft Word Document |
24.5 KB |
Oct 2 2012 12:30 AM |
essentialphysics1.pdf |
PDF Document |
947.7 KB |
Oct 2 2012 12:30 AM |
Ethiopian Government Begs After Bumper Crop.htm |
HTML File |
2.2 KB |
Oct 2 2012 12:31 AM |
eugenics.htm |
HTML File |
32.9 KB |
Oct 2 2012 12:29 AM |
eugenics.html |
HTML File |
32.9 KB |
Oct 2 2012 12:31 AM |
EugenicsManifesto.pdf |
PDF Document |
346.2 KB |
Oct 2 2012 12:27 AM |
EURO-DNA1.0 & ANCESTRYBYDNA2.5 - USER MANUAL.pdf |
PDF Document |
249.1 KB |
Oct 2 2012 12:30 AM |
Euro 2005 DVD.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:32 AM |
European Origins of Halloween.htm |
HTML File |
6.2 KB |
Oct 2 2012 12:28 AM |
Europeans Having Second Thoughts about Turkey.htm |
HTML File |
6 KB |
Oct 2 2012 12:31 AM |
European Union Applies 'Hate Speech' Rules to Internet.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:30 AM |
Europe’s Successful Moon Probe Mission.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:28 AM |
Euro Slurs and Hate Caricatures.htm |
HTML File |
22.3 KB |
Oct 2 2012 12:33 AM |
euvolution.pdf |
PDF Document |
3.7 MB |
Oct 2 2012 12:28 AM |
Evan Thomas 2005-11-04 - UN to Celebrate Jan. 27 as 'Holocaust Day' |
27 AS 'HOLOCAUST DAY' File |
5.1 KB |
Oct 2 2012 12:29 AM |
Ex-IRA Soldier Condemns Loss of Traditional Ireland.htm |
HTML File |
3 KB |
Oct 2 2012 12:28 AM |
Ex-Security Chief Blows Whistle on UN's Kosovo Mission.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:30 AM |
Exercise, It’s Not What Your Doctor Prescribed.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:33 AM |
exiles.zip |
ZIP Archive |
129.8 KB |
Oct 2 2012 12:31 AM |
Exodus Remembered_ Passover Inspires Parasite Jewish Concern for Immigrants (But None for Well-Being of Host Nation Citizens).html |
HTML File |
40.8 KB |
Oct 2 2012 12:28 AM |
F95-2.htm |
HTML File |
8.4 KB |
Oct 2 2012 12:33 AM |
Facts.pdf |
PDF Document |
2.7 MB |
Oct 2 2012 12:33 AM |
Facts To Consider Concerning The Holocaust.htm |
HTML File |
120.4 KB |
Oct 2 2012 12:30 AM |
Fading Illusions - D-Day and Reagan.htm |
HTML File |
26.4 KB |
Oct 2 2012 12:27 AM |
Fagan Files $1 Billion 'Holocaust Compensation' Lawsuit.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:28 AM |
FagFacts.pdf |
PDF Document |
194.1 KB |
Oct 2 2012 12:31 AM |
FagFlyer.pdf |
PDF Document |
50.3 KB |
Oct 2 2012 12:31 AM |
failurerateonmathtestup50percentincounty.html |
HTML File |
4.9 KB |
Oct 2 2012 12:28 AM |
Failures of Our Age - Capitalism and Communism.htm |
HTML File |
23.9 KB |
Oct 2 2012 12:33 AM |
fame.css |
Stylesheet |
784 Bytes |
Oct 2 2012 12:31 AM |
fame.pdf |
PDF Document |
2.3 MB |
Oct 2 2012 12:31 AM |
fame.zip |
ZIP Archive |
450.4 KB |
Oct 2 2012 12:28 AM |
famedeadmansdeeds.pdf |
PDF Document |
2.3 MB |
Oct 2 2012 12:34 AM |
Famous people with Scotch Irish blood.htm |
HTML File |
105.3 KB |
Oct 2 2012 12:32 AM |
faq.html |
HTML File |
58.4 KB |
Oct 2 2012 12:27 AM |
faq_francaise.html |
HTML File |
58.7 KB |
Oct 2 2012 12:33 AM |
Farewell to a Good European.htm |
HTML File |
6.3 KB |
Oct 2 2012 12:31 AM |
Fast Times at Regnef High - crying-wolf.htm |
HTML File |
37.1 KB |
Oct 2 2012 12:33 AM |
Fear and Illusion.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:31 AM |
FearAndTrembling.pdf |
PDF Document |
324.8 KB |
Oct 2 2012 12:32 AM |
Feb01.pdf |
PDF Document |
392.4 KB |
Oct 2 2012 12:28 AM |
Feb02.pdf |
PDF Document |
1.7 MB |
Oct 2 2012 12:29 AM |
feb03.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:28 AM |
Feb04.pdf |
PDF Document |
1.9 MB |
Oct 2 2012 12:34 AM |
Feds Say Katrina Refugee Gangs a Threat.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:33 AM |
FestumAlbum.doc |
Microsoft Word Document |
540 KB |
Oct 2 2012 12:27 AM |
FEST_FLIER.pdf |
PDF Document |
8.5 KB |
Oct 2 2012 12:27 AM |
Fewer Than 50,000 Whites in Zimbabwe.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:33 AM |
FFNewsF05.pdf |
PDF Document |
668 KB |
Oct 2 2012 12:30 AM |
fhe part1.pdf |
PDF Document |
13.6 MB |
Oct 2 2012 12:27 AM |
fhe part2.pdf |
PDF Document |
9.9 MB |
Oct 2 2012 12:33 AM |
fhe part3.pdf |
PDF Document |
15.4 MB |
Oct 2 2012 12:31 AM |
fhe part4.pdf |
PDF Document |
7.3 MB |
Oct 2 2012 12:30 AM |
fhe part5.pdf |
PDF Document |
5.4 MB |
Oct 2 2012 12:32 AM |
fhe part6.pdf |
PDF Document |
4.7 MB |
Oct 2 2012 12:29 AM |
fhe part7.pdf |
PDF Document |
3.6 MB |
Oct 2 2012 12:27 AM |
fhe part8.pdf |
PDF Document |
4.2 MB |
Oct 2 2012 12:31 AM |
fhe part9.pdf |
PDF Document |
14 MB |
Oct 2 2012 12:32 AM |
fhe part10.pdf |
PDF Document |
9.6 MB |
Oct 2 2012 12:34 AM |
fhe part11.pdf |
PDF Document |
6.9 MB |
Oct 2 2012 12:33 AM |
fhe part12.pdf |
PDF Document |
857.3 KB |
Oct 2 2012 12:28 AM |
Fighting Organized Crime.htm |
HTML File |
26.4 KB |
Oct 2 2012 12:28 AM |
Final Verdict - The false connection between Tim McVeigh and The Turner Diaries.htm |
HTML File |
27.8 KB |
Oct 2 2012 12:31 AM |
Finkelstein Debates Israeli Pol.htm |
HTML File |
15.1 KB |
Oct 2 2012 12:31 AM |
first10years.doc |
Microsoft Word Document |
110 KB |
Oct 2 2012 12:33 AM |
FirstTheyCameForTheArabs.pdf |
PDF Document |
18.7 KB |
Oct 2 2012 12:30 AM |
Five Myths That Sanction Israel's War Crimes.htm |
HTML File |
50.3 KB |
Oct 2 2012 12:33 AM |
FLIER-1.pdf |
PDF Document |
110.9 KB |
Oct 2 2012 12:27 AM |
FLIER-2.pdf |
PDF Document |
46 KB |
Oct 2 2012 12:32 AM |
FLIER-3.pdf |
PDF Document |
51.1 KB |
Oct 2 2012 12:31 AM |
FLIER-4.pdf |
PDF Document |
80.4 KB |
Oct 2 2012 12:27 AM |
FLIER-5.pdf |
PDF Document |
84.7 KB |
Oct 2 2012 12:30 AM |
fliers.html |
HTML File |
43.7 KB |
Oct 2 2012 12:34 AM |
FlorentineChronicle.pdf |
PDF Document |
40.9 KB |
Oct 2 2012 12:32 AM |
Florida - 'King Tut' Prompts Black Protests.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:34 AM |
Florida - Homeowners Association Says 'No' to Evacuees.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:31 AM |
Florida - Vote Ubele.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:31 AM |
Florida School Board Rejects Hall's Resignation.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:33 AM |
FLYER-6.pdf |
PDF Document |
88.1 KB |
Oct 2 2012 12:27 AM |
Flyer.pdf |
PDF Document |
486.8 KB |
Oct 2 2012 12:33 AM |
FOMCalendar.pdf |
PDF Document |
91.7 KB |
Oct 2 2012 12:31 AM |
ForeignersAroundTheWorld.pdf |
PDF Document |
740.5 KB |
Oct 2 2012 12:34 AM |
Foreword to the new edition - Zundel's Story.htm |
HTML File |
31.2 KB |
Oct 2 2012 12:32 AM |
Former Reps. Earl Hilliard (D-Ala.) and Cynthia McKinney (D-Ga.) - Bad for Israel.htm |
HTML File |
4 KB |
Oct 2 2012 12:29 AM |
foundingizzymyths.pdf |
PDF Document |
916.3 KB |
Oct 2 2012 12:30 AM |
foundingizzymyths.rtf |
RTF File |
525.9 KB |
Oct 2 2012 12:29 AM |
France - Another 'Hate Crime' Hoax.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:30 AM |
France - Chirac Calls for Police State to Enforce Multiracialism.htm |
HTML File |
5.4 KB |
Oct 2 2012 12:28 AM |
France - Teacher in Hiding.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:33 AM |
France - Turks Must Admit Genocide.htm |
HTML File |
3 KB |
Oct 2 2012 12:27 AM |
France Lays Dauphin to Rest.htm |
HTML File |
5.2 KB |
Oct 2 2012 12:30 AM |
frankdiaryfraud.pdf |
PDF Document |
111.4 KB |
Oct 2 2012 12:30 AM |
Frank Ellis article (unedited) - 2006-03-27 - Chris Brand comment.txt |
Text File |
24.5 KB |
Oct 2 2012 12:33 AM |
Frankfurt School Aikido.htm |
HTML File |
26.7 KB |
Oct 2 2012 12:32 AM |
FrankLynchedLarge.jpeg |
JPEG Image |
77.5 KB |
Oct 2 2012 12:33 AM |
Frank Roman - 2006-10-07 - Impeach The System.htm |
HTML File |
6.4 KB |
Oct 2 2012 12:30 AM |
freeamericaflyer.pdf |
PDF Document |
127.4 KB |
Oct 2 2012 12:32 AM |
Free Pro-European Music.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:28 AM |
Free Speech Can Be Fatal.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:31 AM |
Free Speech Hypocrisy.htm |
HTML File |
1.9 KB |
Oct 2 2012 12:32 AM |
free_irving.pdf |
PDF Document |
471.4 KB |
Oct 2 2012 12:31 AM |
French culture in vice grip of Muslims both internally and externally.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:30 AM |
Friends of Ulster - USA Scotch Irish _ Ulster Scots.htm |
HTML File |
419.1 KB |
Oct 2 2012 12:31 AM |
FRIPamphlets.pdf |
PDF Document |
727.2 KB |
Oct 2 2012 12:28 AM |
Front National MP Suspended from Teaching Position for Calling for Open Debate.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:34 AM |
fs001a.html |
HTML File |
19.1 KB |
Oct 2 2012 12:32 AM |
fs001b.html |
HTML File |
19.5 KB |
Oct 2 2012 12:34 AM |
fs001c.html |
HTML File |
18.8 KB |
Oct 2 2012 12:32 AM |
fs001d.html |
HTML File |
19.2 KB |
Oct 2 2012 12:33 AM |
fs0010a.html |
HTML File |
19.8 KB |
Oct 2 2012 12:31 AM |
fs0010b.html |
HTML File |
19.5 KB |
Oct 2 2012 12:31 AM |
fs0010c.html |
HTML File |
19.4 KB |
Oct 2 2012 12:31 AM |
fs0010d.html |
HTML File |
20 KB |
Oct 2 2012 12:28 AM |
fs0011a.html |
HTML File |
19.9 KB |
Oct 2 2012 12:33 AM |
fs0011b.html |
HTML File |
20.1 KB |
Oct 2 2012 12:33 AM |
fs0011c.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs0011d.html |
HTML File |
19.6 KB |
Oct 2 2012 12:31 AM |
fs0012a.html |
HTML File |
19.2 KB |
Oct 2 2012 12:29 AM |
fs0012b.html |
HTML File |
20 KB |
Oct 2 2012 12:32 AM |
fs0012c.html |
HTML File |
19.8 KB |
Oct 2 2012 12:31 AM |
fs0012d.html |
HTML File |
19.2 KB |
Oct 2 2012 12:31 AM |
fs002a.html |
HTML File |
19.5 KB |
Oct 2 2012 12:28 AM |
fs002b.html |
HTML File |
19.2 KB |
Oct 2 2012 12:32 AM |
fs002c.html |
HTML File |
19 KB |
Oct 2 2012 12:27 AM |
fs002d.html |
HTML File |
20.5 KB |
Oct 2 2012 12:33 AM |
fs003a.html |
HTML File |
20 KB |
Oct 2 2012 12:33 AM |
fs003b.html |
HTML File |
19.8 KB |
Oct 2 2012 12:29 AM |
fs003c.html |
HTML File |
19.2 KB |
Oct 2 2012 12:29 AM |
fs003d.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs004a.html |
HTML File |
19.5 KB |
Oct 2 2012 12:29 AM |
fs004b.html |
HTML File |
19.2 KB |
Oct 2 2012 12:31 AM |
fs004c.html |
HTML File |
19.2 KB |
Oct 2 2012 12:31 AM |
fs004d.html |
HTML File |
19.8 KB |
Oct 2 2012 12:33 AM |
fs005a.html |
HTML File |
20 KB |
Oct 2 2012 12:28 AM |
fs005b.html |
HTML File |
20 KB |
Oct 2 2012 12:29 AM |
fs005c.html |
HTML File |
20.2 KB |
Oct 2 2012 12:29 AM |
fs005d.html |
HTML File |
19.2 KB |
Oct 2 2012 12:30 AM |
fs006a.html |
HTML File |
20.3 KB |
Oct 2 2012 12:31 AM |
fs006b.html |
HTML File |
19.7 KB |
Oct 2 2012 12:30 AM |
fs006c.html |
HTML File |
19.7 KB |
Oct 2 2012 12:29 AM |
fs006d.html |
HTML File |
19.7 KB |
Oct 2 2012 12:28 AM |
fs007a.html |
HTML File |
20 KB |
Oct 2 2012 12:31 AM |
fs007b.html |
HTML File |
19.6 KB |
Oct 2 2012 12:31 AM |
fs007c.html |
HTML File |
20.3 KB |
Oct 2 2012 12:29 AM |
fs007d.html |
HTML File |
20 KB |
Oct 2 2012 12:33 AM |
fs008a.html |
HTML File |
19.4 KB |
Oct 2 2012 12:31 AM |
fs008b.html |
HTML File |
19.8 KB |
Oct 2 2012 12:28 AM |
fs008c.html |
HTML File |
19.9 KB |
Oct 2 2012 12:31 AM |
fs008d.html |
HTML File |
20.4 KB |
Oct 2 2012 12:33 AM |
fs009a.html |
HTML File |
19.9 KB |
Oct 2 2012 12:33 AM |
fs009b.html |
HTML File |
19.1 KB |
Oct 2 2012 12:32 AM |
fs009c.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs009d.html |
HTML File |
19.4 KB |
Oct 2 2012 12:33 AM |
fs0101a.html |
HTML File |
20 KB |
Oct 2 2012 12:33 AM |
fs0101b.html |
HTML File |
20.2 KB |
Oct 2 2012 12:28 AM |
fs0101c.html |
HTML File |
20.4 KB |
Oct 2 2012 12:31 AM |
fs0101d.html |
HTML File |
20.4 KB |
Oct 2 2012 12:33 AM |
fs0102a.html |
HTML File |
19.7 KB |
Oct 2 2012 12:33 AM |
fs0102b.html |
HTML File |
20.3 KB |
Oct 2 2012 12:30 AM |
fs0102c.html |
HTML File |
19.1 KB |
Oct 2 2012 12:28 AM |
fs0102d.html |
HTML File |
19.8 KB |
Oct 2 2012 12:32 AM |
fs0103a.html |
HTML File |
20.3 KB |
Oct 2 2012 12:31 AM |
fs0103b.html |
HTML File |
20 KB |
Oct 2 2012 12:30 AM |
fs0103c.html |
HTML File |
20.1 KB |
Oct 2 2012 12:33 AM |
fs0103d.html |
HTML File |
20.4 KB |
Oct 2 2012 12:28 AM |
fs0104a.html |
HTML File |
20.1 KB |
Oct 2 2012 12:31 AM |
fs0104b.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs0104c.html |
HTML File |
19.8 KB |
Oct 2 2012 12:27 AM |
fs0104d.html |
HTML File |
20.2 KB |
Oct 2 2012 12:31 AM |
fs0105a.html |
HTML File |
19.5 KB |
Oct 2 2012 12:28 AM |
fs0105b.html |
HTML File |
20.1 KB |
Oct 2 2012 12:28 AM |
fs0105c.html |
HTML File |
19.9 KB |
Oct 2 2012 12:31 AM |
fs0105d.html |
HTML File |
19.1 KB |
Oct 2 2012 12:33 AM |
fs0106a.html |
HTML File |
19.1 KB |
Oct 2 2012 12:31 AM |
fs0106b.html |
HTML File |
19.9 KB |
Oct 2 2012 12:28 AM |
fs0106c.html |
HTML File |
18.5 KB |
Oct 2 2012 12:30 AM |
fs0106d.html |
HTML File |
20.2 KB |
Oct 2 2012 12:34 AM |
fs0107a.html |
HTML File |
19.8 KB |
Oct 2 2012 12:28 AM |
fs0107b.html |
HTML File |
19.7 KB |
Oct 2 2012 12:32 AM |
fs0107c.html |
HTML File |
20.1 KB |
Oct 2 2012 12:27 AM |
fs0107d.html |
HTML File |
20.2 KB |
Oct 2 2012 12:31 AM |
fs0108a.html |
HTML File |
19.9 KB |
Oct 2 2012 12:32 AM |
fs0108b.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs0108c.html |
HTML File |
20.1 KB |
Oct 2 2012 12:30 AM |
fs0108d.html |
HTML File |
19.2 KB |
Oct 2 2012 12:31 AM |
fs0109a.html |
HTML File |
20.1 KB |
Oct 2 2012 12:33 AM |
fs0109b.html |
HTML File |
20.4 KB |
Oct 2 2012 12:31 AM |
fs0109c.html |
HTML File |
20.3 KB |
Oct 2 2012 12:30 AM |
fs0109d.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs0110a.html |
HTML File |
20.4 KB |
Oct 2 2012 12:28 AM |
fs0110b.html |
HTML File |
21.9 KB |
Oct 2 2012 12:34 AM |
fs0110c.html |
HTML File |
20.5 KB |
Oct 2 2012 12:31 AM |
fs0110d.html |
HTML File |
20.2 KB |
Oct 2 2012 12:33 AM |
fs0111a.html |
HTML File |
20.7 KB |
Oct 2 2012 12:28 AM |
fs0111b.html |
HTML File |
20.1 KB |
Oct 2 2012 12:28 AM |
fs0111c.html |
HTML File |
20.5 KB |
Oct 2 2012 12:33 AM |
fs0111d.html |
HTML File |
21.2 KB |
Oct 2 2012 12:31 AM |
fs0112a.html |
HTML File |
19.2 KB |
Oct 2 2012 12:31 AM |
fs0112b.html |
HTML File |
20 KB |
Oct 2 2012 12:28 AM |
fs0112c.html |
HTML File |
20.2 KB |
Oct 2 2012 12:27 AM |
fs0112d.html |
HTML File |
20.4 KB |
Oct 2 2012 12:31 AM |
FS02-10.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:30 AM |
fs0201a.html |
HTML File |
20.2 KB |
Oct 2 2012 12:33 AM |
fs0201b.html |
HTML File |
19.8 KB |
Oct 2 2012 12:33 AM |
fs0201c.html |
HTML File |
20 KB |
Oct 2 2012 12:30 AM |
fs0201d.html |
HTML File |
19.9 KB |
Oct 2 2012 12:32 AM |
fs0202a.html |
HTML File |
19.7 KB |
Oct 2 2012 12:29 AM |
fs0202b.html |
HTML File |
20.2 KB |
Oct 2 2012 12:29 AM |
fs0202c.html |
HTML File |
20.2 KB |
Oct 2 2012 12:34 AM |
fs0202d.html |
HTML File |
20.6 KB |
Oct 2 2012 12:32 AM |
fs0203a.html |
HTML File |
20.2 KB |
Oct 2 2012 12:30 AM |
fs0203b.html |
HTML File |
20 KB |
Oct 2 2012 12:32 AM |
fs0203c.html |
HTML File |
19.3 KB |
Oct 2 2012 12:33 AM |
fs0203d.html |
HTML File |
20.1 KB |
Oct 2 2012 12:27 AM |
fs0204a.html |
HTML File |
20.3 KB |
Oct 2 2012 12:34 AM |
fs0204b.html |
HTML File |
19.4 KB |
Oct 2 2012 12:28 AM |
fs0204c.html |
HTML File |
20.3 KB |
Oct 2 2012 12:34 AM |
fs0204d.html |
HTML File |
20.2 KB |
Oct 2 2012 12:28 AM |
fs0205a.html |
HTML File |
19.5 KB |
Oct 2 2012 12:32 AM |
fs0205b.html |
HTML File |
19.9 KB |
Oct 2 2012 12:31 AM |
fs0205c.html |
HTML File |
19.3 KB |
Oct 2 2012 12:29 AM |
fs0205d.html |
HTML File |
20.5 KB |
Oct 2 2012 12:31 AM |
fs0206a.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs0206b.html |
HTML File |
19.7 KB |
Oct 2 2012 12:28 AM |
fs0206c.html |
HTML File |
20.1 KB |
Oct 2 2012 12:33 AM |
fs0206d.html |
HTML File |
19.7 KB |
Oct 2 2012 12:34 AM |
fs0207a.html |
HTML File |
20.3 KB |
Oct 2 2012 12:29 AM |
fs0207b.html |
HTML File |
19.4 KB |
Oct 2 2012 12:31 AM |
fs0207c.html |
HTML File |
19.7 KB |
Oct 2 2012 12:27 AM |
fs0207d.html |
HTML File |
20.2 KB |
Oct 2 2012 12:29 AM |
fs0208a.html |
HTML File |
20.2 KB |
Oct 2 2012 12:33 AM |
fs0208b.html |
HTML File |
19.5 KB |
Oct 2 2012 12:27 AM |
fs0208c.html |
HTML File |
39.1 KB |
Oct 2 2012 12:28 AM |
fs0209a.html |
HTML File |
15.8 KB |
Oct 2 2012 12:32 AM |
fs0209b.html |
HTML File |
21.8 KB |
Oct 2 2012 12:28 AM |
fs0209c.html |
HTML File |
19.1 KB |
Oct 2 2012 12:33 AM |
fs0209d.html |
HTML File |
20.4 KB |
Oct 2 2012 12:27 AM |
fs951a.html |
HTML File |
19.7 KB |
Oct 2 2012 12:30 AM |
fs951b.html |
HTML File |
18.5 KB |
Oct 2 2012 12:31 AM |
fs951c.html |
HTML File |
20 KB |
Oct 2 2012 12:32 AM |
fs951d.html |
HTML File |
9 KB |
Oct 2 2012 12:28 AM |
fs952a.html |
HTML File |
18.3 KB |
Oct 2 2012 12:33 AM |
fs952b.html |
HTML File |
8.4 KB |
Oct 2 2012 12:31 AM |
fs952c.html |
HTML File |
10.4 KB |
Oct 2 2012 12:32 AM |
fs952d.html |
HTML File |
6.7 KB |
Oct 2 2012 12:33 AM |
fs952e.html |
HTML File |
17 KB |
Oct 2 2012 12:31 AM |
fs953a.html |
HTML File |
9.5 KB |
Oct 2 2012 12:33 AM |
fs953b.html |
HTML File |
6.8 KB |
Oct 2 2012 12:31 AM |
fs953c.html |
HTML File |
18.6 KB |
Oct 2 2012 12:33 AM |
fs953d.html |
HTML File |
12.9 KB |
Oct 2 2012 12:34 AM |
fs953e.html |
HTML File |
15.6 KB |
Oct 2 2012 12:34 AM |
fs954a.html |
HTML File |
17.9 KB |
Oct 2 2012 12:34 AM |
fs954b.html |
HTML File |
33 KB |
Oct 2 2012 12:32 AM |
fs954c.html |
HTML File |
18.5 KB |
Oct 2 2012 12:31 AM |
fs955a.html |
HTML File |
18 KB |
Oct 2 2012 12:31 AM |
fs955b.html |
HTML File |
20.2 KB |
Oct 2 2012 12:34 AM |
fs955c.html |
HTML File |
18.7 KB |
Oct 2 2012 12:29 AM |
fs955d.html |
HTML File |
20.3 KB |
Oct 2 2012 12:34 AM |
fs956a.html |
HTML File |
37.8 KB |
Oct 2 2012 12:33 AM |
fs956b.html |
HTML File |
31.2 KB |
Oct 2 2012 12:33 AM |
fs957a.html |
HTML File |
16.8 KB |
Oct 2 2012 12:29 AM |
fs957b.html |
HTML File |
16.9 KB |
Oct 2 2012 12:33 AM |
fs957c.html |
HTML File |
9.2 KB |
Oct 2 2012 12:33 AM |
fs957d.html |
HTML File |
5.3 KB |
Oct 2 2012 12:31 AM |
fs957e.html |
HTML File |
8.1 KB |
Oct 2 2012 12:28 AM |
fs958a.html |
HTML File |
22.3 KB |
Oct 2 2012 12:34 AM |
fs958d.html |
HTML File |
18.1 KB |
Oct 2 2012 12:32 AM |
fs958e.html |
HTML File |
18.5 KB |
Oct 2 2012 12:32 AM |
fs958f.html |
HTML File |
7.1 KB |
Oct 2 2012 12:31 AM |
fs959a.html |
HTML File |
19 KB |
Oct 2 2012 12:32 AM |
fs959b.html |
HTML File |
4.7 KB |
Oct 2 2012 12:28 AM |
fs959c.html |
HTML File |
16.1 KB |
Oct 2 2012 12:30 AM |
fs959d.html |
HTML File |
14.9 KB |
Oct 2 2012 12:29 AM |
fs961a.html |
HTML File |
19 KB |
Oct 2 2012 12:33 AM |
fs961b.html |
HTML File |
18.5 KB |
Oct 2 2012 12:32 AM |
fs961c.html |
HTML File |
16.3 KB |
Oct 2 2012 12:34 AM |
fs961d.html |
HTML File |
20.6 KB |
Oct 2 2012 12:32 AM |
fs962a.html |
HTML File |
17.4 KB |
Oct 2 2012 12:28 AM |
fs962b.html |
HTML File |
19 KB |
Oct 2 2012 12:28 AM |
fs962c.html |
HTML File |
3.5 KB |
Oct 2 2012 12:28 AM |
fs962d.html |
HTML File |
16.8 KB |
Oct 2 2012 12:28 AM |
fs962e.html |
HTML File |
19.3 KB |
Oct 2 2012 12:29 AM |
fs963a.html |
HTML File |
18.3 KB |
Oct 2 2012 12:27 AM |
fs963b.html |
HTML File |
4.2 KB |
Oct 2 2012 12:33 AM |
fs963c.html |
HTML File |
14.3 KB |
Oct 2 2012 12:31 AM |
fs963d.html |
HTML File |
19.1 KB |
Oct 2 2012 12:28 AM |
fs964a.html |
HTML File |
22.4 KB |
Oct 2 2012 12:34 AM |
fs964b.html |
HTML File |
19.3 KB |
Oct 2 2012 12:28 AM |
fs964c.html |
HTML File |
3.1 KB |
Oct 2 2012 12:32 AM |
fs964d.html |
HTML File |
19.2 KB |
Oct 2 2012 12:31 AM |
fs964e.html |
HTML File |
18.3 KB |
Oct 2 2012 12:34 AM |
fs965a.html |
HTML File |
19.3 KB |
Oct 2 2012 12:29 AM |
fs965b.html |
HTML File |
15.1 KB |
Oct 2 2012 12:28 AM |
fs965c.html |
HTML File |
19.1 KB |
Oct 2 2012 12:31 AM |
fs965d.html |
HTML File |
16.3 KB |
Oct 2 2012 12:29 AM |
fs965e.html |
HTML File |
2.2 KB |
Oct 2 2012 12:30 AM |
fs966a.html |
HTML File |
15.7 KB |
Oct 2 2012 12:32 AM |
fs966b.html |
HTML File |
19.7 KB |
Oct 2 2012 12:28 AM |
fs966c.html |
HTML File |
15.9 KB |
Oct 2 2012 12:31 AM |
fs966d.html |
HTML File |
18.6 KB |
Oct 2 2012 12:29 AM |
fs967a.html |
HTML File |
20.5 KB |
Oct 2 2012 12:32 AM |
fs967b.html |
HTML File |
3.7 KB |
Oct 2 2012 12:31 AM |
fs967c.html |
HTML File |
18.9 KB |
Oct 2 2012 12:31 AM |
fs967d.html |
HTML File |
8.8 KB |
Oct 2 2012 12:33 AM |
fs967e.html |
HTML File |
18.8 KB |
Oct 2 2012 12:28 AM |
fs967f.html |
HTML File |
18.6 KB |
Oct 2 2012 12:31 AM |
fs968a.html |
HTML File |
17.7 KB |
Oct 2 2012 12:33 AM |
fs968b.html |
HTML File |
16.4 KB |
Oct 2 2012 12:27 AM |
fs968c.html |
HTML File |
19.1 KB |
Oct 2 2012 12:34 AM |
fs968d.html |
HTML File |
18 KB |
Oct 2 2012 12:33 AM |
fs969a.html |
HTML File |
17.1 KB |
Oct 2 2012 12:29 AM |
fs969b.html |
HTML File |
18.8 KB |
Oct 2 2012 12:32 AM |
fs969c.html |
HTML File |
19.9 KB |
Oct 2 2012 12:28 AM |
fs969d.html |
HTML File |
18.6 KB |
Oct 2 2012 12:28 AM |
fs971a.html |
HTML File |
17.7 KB |
Oct 2 2012 12:30 AM |
fs971b.html |
HTML File |
29.3 KB |
Oct 2 2012 12:29 AM |
fs971c.html |
HTML File |
17.3 KB |
Oct 2 2012 12:34 AM |
fs972a.html |
HTML File |
17.3 KB |
Oct 2 2012 12:32 AM |
fs972b.html |
HTML File |
17.1 KB |
Oct 2 2012 12:29 AM |
fs972c.html |
HTML File |
17.3 KB |
Oct 2 2012 12:31 AM |
fs972d.html |
HTML File |
17.7 KB |
Oct 2 2012 12:31 AM |
fs973a.html |
HTML File |
17.6 KB |
Oct 2 2012 12:30 AM |
fs973b.html |
HTML File |
18.5 KB |
Oct 2 2012 12:28 AM |
fs973c.html |
HTML File |
18.6 KB |
Oct 2 2012 12:29 AM |
fs973d.html |
HTML File |
15.8 KB |
Oct 2 2012 12:32 AM |
fs974a.html |
HTML File |
17.3 KB |
Oct 2 2012 12:31 AM |
fs974b.html |
HTML File |
17.2 KB |
Oct 2 2012 12:34 AM |
fs974c.html |
HTML File |
17.2 KB |
Oct 2 2012 12:32 AM |
fs974d.html |
HTML File |
17.8 KB |
Oct 2 2012 12:31 AM |
fs975a.html |
HTML File |
17.7 KB |
Oct 2 2012 12:31 AM |
fs975b.html |
HTML File |
18 KB |
Oct 2 2012 12:32 AM |
fs975c.html |
HTML File |
18.6 KB |
Oct 2 2012 12:27 AM |
fs975d.html |
HTML File |
17.6 KB |
Oct 2 2012 12:33 AM |
fs976a.html |
HTML File |
17.4 KB |
Oct 2 2012 12:30 AM |
fs976b.html |
HTML File |
17.2 KB |
Oct 2 2012 12:31 AM |
fs976c.html |
HTML File |
17 KB |
Oct 2 2012 12:27 AM |
fs976d.html |
HTML File |
17.7 KB |
Oct 2 2012 12:31 AM |
fs977a.html |
HTML File |
17.9 KB |
Oct 2 2012 12:32 AM |
fs977b.html |
HTML File |
17.6 KB |
Oct 2 2012 12:33 AM |
fs977c.html |
HTML File |
18.1 KB |
Oct 2 2012 12:28 AM |
fs977d.html |
HTML File |
17.5 KB |
Oct 2 2012 12:28 AM |
fs978a.html |
HTML File |
17.5 KB |
Oct 2 2012 12:31 AM |
fs978b.html |
HTML File |
17.1 KB |
Oct 2 2012 12:31 AM |
fs978c.html |
HTML File |
17.1 KB |
Oct 2 2012 12:33 AM |
fs978d.html |
HTML File |
17 KB |
Oct 2 2012 12:33 AM |
fs979a.html |
HTML File |
17.3 KB |
Oct 2 2012 12:34 AM |
fs979b.html |
HTML File |
18 KB |
Oct 2 2012 12:32 AM |
fs979c.html |
HTML File |
17.4 KB |
Oct 2 2012 12:28 AM |
fs979d.html |
HTML File |
17.4 KB |
Oct 2 2012 12:33 AM |
fs981a.html |
HTML File |
16.9 KB |
Oct 2 2012 12:31 AM |
fs981b.html |
HTML File |
16.7 KB |
Oct 2 2012 12:31 AM |
fs981c.html |
HTML File |
17.2 KB |
Oct 2 2012 12:32 AM |
fs981d.html |
HTML File |
17.9 KB |
Oct 2 2012 12:31 AM |
fs982a.html |
HTML File |
18.2 KB |
Oct 2 2012 12:34 AM |
fs982b.html |
HTML File |
17.8 KB |
Oct 2 2012 12:32 AM |
fs982c.html |
HTML File |
17.1 KB |
Oct 2 2012 12:33 AM |
fs982d.html |
HTML File |
16.8 KB |
Oct 2 2012 12:29 AM |
fs983a.html |
HTML File |
16.3 KB |
Oct 2 2012 12:32 AM |
fs983b.html |
HTML File |
18.3 KB |
Oct 2 2012 12:31 AM |
fs983c.html |
HTML File |
18.1 KB |
Oct 2 2012 12:33 AM |
fs983d.html |
HTML File |
17.4 KB |
Oct 2 2012 12:32 AM |
fs984a.html |
HTML File |
17.1 KB |
Oct 2 2012 12:31 AM |
fs984b.html |
HTML File |
17.5 KB |
Oct 2 2012 12:29 AM |
fs984c.html |
HTML File |
18.4 KB |
Oct 2 2012 12:31 AM |
fs984d.html |
HTML File |
17 KB |
Oct 2 2012 12:30 AM |
fs985a.html |
HTML File |
18.4 KB |
Oct 2 2012 12:31 AM |
fs985b.html |
HTML File |
18 KB |
Oct 2 2012 12:28 AM |
fs985c.html |
HTML File |
17.4 KB |
Oct 2 2012 12:33 AM |
fs985d.html |
HTML File |
17.2 KB |
Oct 2 2012 12:29 AM |
fs986a.html |
HTML File |
18.3 KB |
Oct 2 2012 12:34 AM |
fs986b.html |
HTML File |
18.2 KB |
Oct 2 2012 12:28 AM |
fs986c.html |
HTML File |
16.8 KB |
Oct 2 2012 12:33 AM |
fs986d.html |
HTML File |
18.5 KB |
Oct 2 2012 12:32 AM |
fs987a.html |
HTML File |
18.4 KB |
Oct 2 2012 12:30 AM |
fs987b.html |
HTML File |
17.1 KB |
Oct 2 2012 12:31 AM |
fs987c.html |
HTML File |
18.9 KB |
Oct 2 2012 12:30 AM |
fs987d.html |
HTML File |
18.8 KB |
Oct 2 2012 12:33 AM |
fs988a.html |
HTML File |
17.7 KB |
Oct 2 2012 12:32 AM |
fs988b.html |
HTML File |
17.1 KB |
Oct 2 2012 12:27 AM |
fs988c.html |
HTML File |
17.7 KB |
Oct 2 2012 12:31 AM |
fs988d.html |
HTML File |
19.3 KB |
Oct 2 2012 12:31 AM |
fs989a.html |
HTML File |
18.5 KB |
Oct 2 2012 12:27 AM |
fs989b.html |
HTML File |
18.8 KB |
Oct 2 2012 12:28 AM |
fs989c.html |
HTML File |
20 KB |
Oct 2 2012 12:28 AM |
fs989d.html |
HTML File |
19.8 KB |
Oct 2 2012 12:30 AM |
fs991a.html |
HTML File |
20.2 KB |
Oct 2 2012 12:29 AM |
fs991b.html |
HTML File |
19.1 KB |
Oct 2 2012 12:31 AM |
fs991c.html |
HTML File |
20.3 KB |
Oct 2 2012 12:27 AM |
fs991d.html |
HTML File |
19.9 KB |
Oct 2 2012 12:29 AM |
fs992a.html |
HTML File |
20.4 KB |
Oct 2 2012 12:31 AM |
fs992b.html |
HTML File |
20.3 KB |
Oct 2 2012 12:32 AM |
fs992c.html |
HTML File |
19.8 KB |
Oct 2 2012 12:28 AM |
fs992d.html |
HTML File |
19.9 KB |
Oct 2 2012 12:32 AM |
fs993a.html |
HTML File |
19.7 KB |
Oct 2 2012 12:29 AM |
fs993b.html |
HTML File |
19.4 KB |
Oct 2 2012 12:28 AM |
fs993c.html |
HTML File |
20.3 KB |
Oct 2 2012 12:34 AM |
fs993d.html |
HTML File |
20 KB |
Oct 2 2012 12:33 AM |
fs994a.html |
HTML File |
20 KB |
Oct 2 2012 12:32 AM |
fs994b.html |
HTML File |
19.6 KB |
Oct 2 2012 12:31 AM |
fs994c.html |
HTML File |
19.8 KB |
Oct 2 2012 12:31 AM |
fs994d.html |
HTML File |
19.5 KB |
Oct 2 2012 12:31 AM |
fs995a.html |
HTML File |
19.5 KB |
Oct 2 2012 12:27 AM |
fs995b.html |
HTML File |
20.1 KB |
Oct 2 2012 12:34 AM |
fs995c.html |
HTML File |
19.5 KB |
Oct 2 2012 12:31 AM |
fs995d.html |
HTML File |
19.1 KB |
Oct 2 2012 12:31 AM |
fs996a.html |
HTML File |
19.6 KB |
Oct 2 2012 12:32 AM |
fs996b.html |
HTML File |
19.3 KB |
Oct 2 2012 12:33 AM |
fs996c.html |
HTML File |
19.8 KB |
Oct 2 2012 12:32 AM |
fs996d.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs997a.html |
HTML File |
19.9 KB |
Oct 2 2012 12:28 AM |
fs997b.html |
HTML File |
20 KB |
Oct 2 2012 12:30 AM |
fs997c.html |
HTML File |
19.7 KB |
Oct 2 2012 12:30 AM |
fs997d.html |
HTML File |
19.8 KB |
Oct 2 2012 12:32 AM |
fs998a.html |
HTML File |
19.7 KB |
Oct 2 2012 12:31 AM |
fs998b.html |
HTML File |
19.8 KB |
Oct 2 2012 12:31 AM |
fs998c.html |
HTML File |
20 KB |
Oct 2 2012 12:32 AM |
fs998d.html |
HTML File |
19.7 KB |
Oct 2 2012 12:30 AM |
fs999a.html |
HTML File |
19.7 KB |
Oct 2 2012 12:30 AM |
fs999b.html |
HTML File |
19.4 KB |
Oct 2 2012 12:29 AM |
fs999c.html |
HTML File |
20 KB |
Oct 2 2012 12:33 AM |
fs999d.html |
HTML File |
20.1 KB |
Oct 2 2012 12:30 AM |
fs9510a.html |
HTML File |
18.5 KB |
Oct 2 2012 12:33 AM |
fs9510b.html |
HTML File |
18.3 KB |
Oct 2 2012 12:27 AM |
fs9511a.html |
HTML File |
18.6 KB |
Oct 2 2012 12:34 AM |
fs9511c.html |
HTML File |
55.8 KB |
Oct 2 2012 12:31 AM |
fs9511d.html |
HTML File |
18.9 KB |
Oct 2 2012 12:28 AM |
fs9512a.html |
HTML File |
17.9 KB |
Oct 2 2012 12:33 AM |
fs9512b.html |
HTML File |
12.6 KB |
Oct 2 2012 12:31 AM |
fs9512c.html |
HTML File |
7.9 KB |
Oct 2 2012 12:33 AM |
fs9512d.html |
HTML File |
16.4 KB |
Oct 2 2012 12:34 AM |
fs9611a.html |
HTML File |
13.2 KB |
Oct 2 2012 12:31 AM |
fs9611b.html |
HTML File |
18.6 KB |
Oct 2 2012 12:29 AM |
fs9611c.html |
HTML File |
18.4 KB |
Oct 2 2012 12:27 AM |
fs9611d.html |
HTML File |
13.8 KB |
Oct 2 2012 12:31 AM |
fs9612a.html |
HTML File |
61.9 KB |
Oct 2 2012 12:28 AM |
fs9710a.html |
HTML File |
16.7 KB |
Oct 2 2012 12:30 AM |
fs9710b.html |
HTML File |
17.1 KB |
Oct 2 2012 12:27 AM |
fs9710c.html |
HTML File |
17.7 KB |
Oct 2 2012 12:32 AM |
fs9710d.html |
HTML File |
16.4 KB |
Oct 2 2012 12:30 AM |
fs9711a.html |
HTML File |
17.8 KB |
Oct 2 2012 12:31 AM |
fs9711b.html |
HTML File |
18.3 KB |
Oct 2 2012 12:28 AM |
fs9711c.html |
HTML File |
17.2 KB |
Oct 2 2012 12:30 AM |
fs9711d.html |
HTML File |
17.6 KB |
Oct 2 2012 12:31 AM |
fs9712a.html |
HTML File |
18 KB |
Oct 2 2012 12:31 AM |
fs9712b.html |
HTML File |
17.3 KB |
Oct 2 2012 12:32 AM |
fs9712c.html |
HTML File |
17.4 KB |
Oct 2 2012 12:28 AM |
fs9712d.html |
HTML File |
18 KB |
Oct 2 2012 12:28 AM |
fs9810a.html |
HTML File |
19.7 KB |
Oct 2 2012 12:32 AM |
fs9810b.html |
HTML File |
20 KB |
Oct 2 2012 12:31 AM |
fs9810c.html |
HTML File |
20.3 KB |
Oct 2 2012 12:31 AM |
fs9810d.html |
HTML File |
20 KB |
Oct 2 2012 12:33 AM |
fs9811a.html |
HTML File |
19.9 KB |
Oct 2 2012 12:31 AM |
fs9811b.html |
HTML File |
20.3 KB |
Oct 2 2012 12:27 AM |
fs9811c.html |
HTML File |
19.9 KB |
Oct 2 2012 12:29 AM |
fs9811d.html |
HTML File |
19.6 KB |
Oct 2 2012 12:31 AM |
fs9812a.html |
HTML File |
19.9 KB |
Oct 2 2012 12:31 AM |
fs9812b.html |
HTML File |
19.9 KB |
Oct 2 2012 12:28 AM |
fs9812c.html |
HTML File |
19.9 KB |
Oct 2 2012 12:33 AM |
fs9812d.html |
HTML File |
19.6 KB |
Oct 2 2012 12:33 AM |
fs9910a.html |
HTML File |
19.9 KB |
Oct 2 2012 12:31 AM |
fs9910b.html |
HTML File |
20.2 KB |
Oct 2 2012 12:30 AM |
fs9910c.html |
HTML File |
20.1 KB |
Oct 2 2012 12:30 AM |
fs9910d.html |
HTML File |
19.8 KB |
Oct 2 2012 12:27 AM |
fs9911a.html |
HTML File |
19.9 KB |
Oct 2 2012 12:31 AM |
fs9911b.html |
HTML File |
19.2 KB |
Oct 2 2012 12:27 AM |
fs9911c.html |
HTML File |
19.9 KB |
Oct 2 2012 12:29 AM |
fs9911d.html |
HTML File |
20.2 KB |
Oct 2 2012 12:31 AM |
fs9912a.html |
HTML File |
20 KB |
Oct 2 2012 12:31 AM |
fs9912b.html |
HTML File |
20.1 KB |
Oct 2 2012 12:27 AM |
fs9912c.html |
HTML File |
19 KB |
Oct 2 2012 12:31 AM |
fs9912d.html |
HTML File |
19.3 KB |
Oct 2 2012 12:33 AM |
Full Text of Ahmadinejad's Letter to Merkel.htm |
HTML File |
19.3 KB |
Oct 2 2012 12:28 AM |
futureofman.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:27 AM |
ga-1-73.pdf |
PDF Document |
16.3 MB |
Oct 2 2012 12:31 AM |
galileeflowers.pdf |
PDF Document |
2.3 MB |
Oct 2 2012 12:33 AM |
galileeflowers.rtf |
RTF File |
1.1 MB |
Oct 2 2012 12:28 AM |
GasChamberExecution.pdf |
PDF Document |
39.9 KB |
Oct 2 2012 12:33 AM |
gas_prices.pdf |
PDF Document |
164.6 KB |
Oct 2 2012 12:33 AM |
Genes Trace the Ancient Wanderings of White People.htm |
HTML File |
7.8 KB |
Oct 2 2012 12:31 AM |
Genetic Branching - Keep it Going.htm |
HTML File |
13.4 KB |
Oct 2 2012 12:29 AM |
George Orwell - 1984.pdf |
PDF Document |
564.4 KB |
Oct 2 2012 12:31 AM |
GermanLawAndLegislation.pdf |
PDF Document |
64.6 KB |
Oct 2 2012 12:34 AM |
GermanLawAndLegislation.rtf |
RTF File |
88.2 KB |
Oct 2 2012 12:27 AM |
German Politicians Talk Turkey.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:32 AM |
Germany - PC Gift to Patriots.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:33 AM |
getreadyforthecomingconflictwithchina.html |
HTML File |
6 KB |
Oct 2 2012 12:33 AM |
GFactor.pdf |
PDF Document |
722.2 KB |
Oct 2 2012 12:32 AM |
Giant.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:31 AM |
gibson.pdf |
PDF Document |
591.9 KB |
Oct 2 2012 12:28 AM |
gibson_wm_docs_072806.pdf |
PDF Document |
248.1 KB |
Oct 2 2012 12:31 AM |
Give Them Lead, Not Silver.htm |
HTML File |
3 KB |
Oct 2 2012 12:33 AM |
God, Religion, and Tribal Conflict.htm |
HTML File |
30.2 KB |
Oct 2 2012 12:28 AM |
Goebbels.pdf |
PDF Document |
2.9 MB |
Oct 2 2012 12:31 AM |
Goering.pdf |
PDF Document |
3.8 MB |
Oct 2 2012 12:31 AM |
good_jewbad_jew_paradigm - The Mindset that Impedes Civilization's Healing Process.htm |
HTML File |
26.1 KB |
Oct 2 2012 12:31 AM |
Governor Schwarzenegger's Statement Denying Tookie Clemency.htm |
HTML File |
12.4 KB |
Oct 2 2012 12:30 AM |
grafmemoir.pdf |
PDF Document |
153.1 KB |
Oct 2 2012 12:28 AM |
grafmemoir.rtf |
RTF File |
194.8 KB |
Oct 2 2012 12:29 AM |
Gramage's DVD copying guide - v2 .rtf |
RTF File |
16.3 KB |
Oct 2 2012 12:34 AM |
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust.htm |
HTML File |
13.4 KB |
Oct 2 2012 12:32 AM |
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust.txt |
Text File |
11.7 KB |
Oct 2 2012 12:34 AM |
Guazzo.html |
HTML File |
10 KB |
Oct 2 2012 12:28 AM |
Guilt March Hosts Named For Plagiarist.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:27 AM |
guilty.pdf |
PDF Document |
55.4 KB |
Oct 2 2012 12:28 AM |
gulag.html |
HTML File |
3.1 KB |
Oct 2 2012 12:32 AM |
Guts - A White Man Who Won't Back Down.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:32 AM |
Guy Ritchie - Kabbalah Ruined My Film.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:30 AM |
H067172052X.zip |
ZIP Archive |
398.5 KB |
Oct 2 2012 12:28 AM |
Half of Katrina Refugees Are Criminals.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:29 AM |
halfofprisonersareblack.html |
HTML File |
4.6 KB |
Oct 2 2012 12:31 AM |
hans.pdf |
PDF Document |
62.6 KB |
Oct 2 2012 12:33 AM |
Hans Christian Andersen (1845) - Holger Danske.htm |
HTML File |
11.4 KB |
Oct 2 2012 12:29 AM |
Happy German-American Day.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:29 AM |
Harold A. Covington - A Distant Thunder.doc |
Microsoft Word Document |
1.3 MB |
Oct 2 2012 12:34 AM |
Has King Tut Been 'Whitewashed'.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:27 AM |
hate crime.pdf |
PDF Document |
408.8 KB |
Oct 2 2012 12:33 AM |
hatecrimespamphlet.pdf |
PDF Document |
62.2 KB |
Oct 2 2012 12:30 AM |
hatedir.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:31 AM |
hate directory.pdf |
PDF Document |
392.4 KB |
Oct 2 2012 12:31 AM |
Head of Homeland Security Has Ties With Suspected Financier of 911.htm |
HTML File |
2 KB |
Oct 2 2012 12:31 AM |
Heather Mac Donald on Immigration on National Review Online - A Latin conservative tidal wave is not coming.htm |
HTML File |
8 KB |
Oct 2 2012 12:33 AM |
he Jewish Conquest of the World.htm |
HTML File |
71.3 KB |
Oct 2 2012 12:30 AM |
Henry David Thoreau - Civil Disobedience.pdf |
PDF Document |
87.8 KB |
Oct 2 2012 12:28 AM |
Henry Ford - 1922-01-07 - Candid Address to Jews on the Jewish Problem.htm |
HTML File |
29.3 KB |
Oct 2 2012 12:30 AM |
Henry Kissinger - The Walking, Talking Conflict of Interest.htm |
HTML File |
22.4 KB |
Oct 2 2012 12:33 AM |
Hess.pdf |
PDF Document |
2.1 MB |
Oct 2 2012 12:31 AM |
hey're Not All Bad...Are They.htm |
HTML File |
9.6 KB |
Oct 2 2012 12:28 AM |
hey_you.pdf |
PDF Document |
121 KB |
Oct 2 2012 12:31 AM |
Hezbollah Broke Israeli Codes.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:34 AM |
hidden.html |
HTML File |
12.7 KB |
Oct 2 2012 12:31 AM |
HighCostOfVengeance.pdf |
PDF Document |
212.3 KB |
Oct 2 2012 12:33 AM |
High School Failure Rate Highest in Non-White Districts.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:28 AM |
Hilarious PC Language Lesson.htm |
HTML File |
4 KB |
Oct 2 2012 12:28 AM |
HILLARY, TORRICELLI DONOR'S FUNNY MONEY Port's New Head, Sued by Brother, Faces an Inquiry.htm |
HTML File |
62 KB |
Oct 2 2012 12:31 AM |
Himmelfarb.pdf |
PDF Document |
122.3 KB |
Oct 2 2012 12:32 AM |
HispanicsReport.pdf |
PDF Document |
985.5 KB |
Oct 2 2012 12:29 AM |
Historical Myth Justifies Golan Heights Occupation.htm |
HTML File |
5.5 KB |
Oct 2 2012 12:28 AM |
history.html |
HTML File |
51 KB |
Oct 2 2012 12:33 AM |
History of the Original Ku Klux Klan.txt |
Text File |
47.1 KB |
Oct 2 2012 12:31 AM |
histwiz 1.pdf |
PDF Document |
8.7 MB |
Oct 2 2012 12:34 AM |
histwiz 2.pdf |
PDF Document |
1.8 MB |
Oct 2 2012 12:28 AM |
histwiz 3.pdf |
PDF Document |
1.7 MB |
Oct 2 2012 12:33 AM |
histwiz 4.pdf |
PDF Document |
159.3 KB |
Oct 2 2012 12:29 AM |
HitlerLifeOfALeader.pdf |
PDF Document |
6.1 MB |
Oct 2 2012 12:31 AM |
HitlerWeLovedAndWhy.rtf |
RTF File |
88.6 KB |
Oct 2 2012 12:31 AM |
H Millard - Homeless Jack on Iran, Freedom, Intellectuals, and the Holocaust.htm |
HTML File |
12.7 KB |
Oct 2 2012 12:31 AM |
Hmong Immigrant Commits Mass Murder in Northern Wisconsin.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:31 AM |
hoax.pdf |
PDF Document |
12.9 MB |
Oct 2 2012 12:33 AM |
hoax.rtf |
RTF File |
16.4 MB |
Oct 2 2012 12:33 AM |
hoax.zip |
ZIP Archive |
2.3 MB |
Oct 2 2012 12:32 AM |
hoax2.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:31 AM |
Hockney's Secret Knowledge - Refuted.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:33 AM |
Holger Dansk - Denmark's Mountain King.htm |
HTML File |
19.5 KB |
Oct 2 2012 12:31 AM |
holindustry.pdf |
PDF Document |
554.2 KB |
Oct 2 2012 12:31 AM |
holindustry.rtf |
RTF File |
5.3 MB |
Oct 2 2012 12:33 AM |
HollyhoaxMadeInRussia.pdf |
PDF Document |
17.8 MB |
Oct 2 2012 12:30 AM |
Hollywood Slanders Italian Americans.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:28 AM |
Holo-Jokes.pdf |
PDF Document |
53.9 KB |
Oct 2 2012 12:33 AM |
HolocaustDenial2005.pdf |
PDF Document |
259.4 KB |
Oct 2 2012 12:32 AM |
Holocaust Fraud.htm |
HTML File |
13.2 KB |
Oct 2 2012 12:31 AM |
Holocaust Hoax to be Hammered at Upcoming Conference in Iran.htm |
HTML File |
6.7 KB |
Oct 2 2012 12:30 AM |
Holocaust Lawyer Faces $3.2 Million Malpractice Judgment.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:33 AM |
holocaustorhoax.pdf |
PDF Document |
990.4 KB |
Oct 2 2012 12:34 AM |
holocaustorhoax.rtf |
RTF File |
605.3 KB |
Oct 2 2012 12:31 AM |
HolyBookOfAdolfHitler.pdf |
PDF Document |
141.1 KB |
Oct 2 2012 12:30 AM |
HolyBookOfAdolfHitler.rtf |
RTF File |
186.6 KB |
Oct 2 2012 12:33 AM |
Homeland Security's Casualties.htm |
HTML File |
6.8 KB |
Oct 2 2012 12:30 AM |
Homeland Security Nominee Chertoff Aided 9-11 Terror Suspect.htm |
HTML File |
17.4 KB |
Oct 2 2012 12:34 AM |
Homeless Jack Offers a Primer.htm |
HTML File |
13.3 KB |
Oct 2 2012 12:28 AM |
Homeless Jack on New Orleans.htm |
HTML File |
8.3 KB |
Oct 2 2012 12:32 AM |
Home on the Range.htm |
HTML File |
6.9 KB |
Oct 2 2012 12:31 AM |
Homosexual Groups Trying to Distance Themselves From Foley.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
Honest Money.pdf |
PDF Document |
225 KB |
Oct 2 2012 12:33 AM |
Honoring Robert E. Lee.htm |
HTML File |
10.7 KB |
Oct 2 2012 12:31 AM |
Houston - Turf War Breaks Out between Katrina Refugees, Locals.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:33 AM |
How a Non-White Country Treats Asylum Invaders.htm |
HTML File |
6.1 KB |
Oct 2 2012 12:30 AM |
How Many More Nations Will Israel Attack.htm |
HTML File |
10.3 KB |
Oct 2 2012 12:34 AM |
How Many Tanks Did Israel Lose.htm |
HTML File |
5 KB |
Oct 2 2012 12:28 AM |
How Muslims Deal With Third World Immigrants.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:27 AM |
How New Orleans Was Lost.htm |
HTML File |
3 KB |
Oct 2 2012 12:33 AM |
How Small Genetic Differences Give Racial Divergency.htm |
HTML File |
21.1 KB |
Oct 2 2012 12:28 AM |
How To Burn Bootable Disks & Install OS X from External Volumes.rtf |
RTF File |
13.9 KB |
Oct 2 2012 12:30 AM |
How to Crack CD Protections.pdf |
PDF Document |
30 KB |
Oct 2 2012 12:31 AM |
How to Develop Super Power Memory.pdf |
PDF Document |
2.5 MB |
Oct 2 2012 12:31 AM |
How to rebuild a Li-Ion pack.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:33 AM |
How Unskilled Immigrants Hurt Our Economy.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:33 AM |
hsb.pdf |
PDF Document |
442.9 KB |
Oct 2 2012 12:28 AM |
hsb.rtf |
RTF File |
1.2 MB |
Oct 2 2012 12:29 AM |
hsb.zip |
ZIP Archive |
205.4 KB |
Oct 2 2012 12:30 AM |
htpt.pdf |
PDF Document |
864.7 KB |
Oct 2 2012 12:28 AM |
htpt.rtf |
RTF File |
473.6 KB |
Oct 2 2012 12:34 AM |
http__www.hartford-hwp.com_cp-usa.html |
HTML File |
1.9 KB |
Oct 2 2012 12:31 AM |
Hueng Metal Hydrides BCC 033003.pdf |
PDF Document |
898.9 KB |
Oct 2 2012 12:28 AM |
Hugo Chavez - Rise Up Against the Empire.htm |
HTML File |
18.3 KB |
Oct 2 2012 12:27 AM |
human_shields.pdf |
PDF Document |
471.2 KB |
Oct 2 2012 12:28 AM |
humor.html |
HTML File |
21.7 KB |
Oct 2 2012 12:31 AM |
hunter.css |
Stylesheet |
503 Bytes |
Oct 2 2012 12:28 AM |
Hunter.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:33 AM |
Hurricane Katrina - Blacks Worsen Disaster.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:33 AM |
Hurricane Katrina and Black Behavior.htm |
HTML File |
4.7 KB |
Oct 2 2012 12:29 AM |
Hurricane Katrina Devastates Duke Headquarters.htm |
HTML File |
6.1 KB |
Oct 2 2012 12:33 AM |
Hurricane Tracking Chart - Atlantic Basin.pdf |
PDF Document |
107.8 KB |
Oct 2 2012 12:28 AM |
Hurricane Tracking Chart - Atlantic Basin West.pdf |
PDF Document |
906.4 KB |
Oct 2 2012 12:31 AM |
Hurricane Tracking Chart - East Pacific.pdf |
PDF Document |
289.3 KB |
Oct 2 2012 12:33 AM |
Hushed-up Israeli Spy Operations against USA and Mexico 2000 - 2003.htm |
HTML File |
34.1 KB |
Oct 2 2012 12:28 AM |
HW1.pdf |
PDF Document |
3.6 MB |
Oct 2 2012 12:31 AM |
hwr60.htm |
HTML File |
35.5 KB |
Oct 2 2012 12:28 AM |
hwr61.htm |
HTML File |
10 KB |
Oct 2 2012 12:32 AM |
HWT-Brizahpage.PDF |
PDF Document |
452.4 KB |
Oct 2 2012 12:30 AM |
HW_Web.pdf |
PDF Document |
3.9 MB |
Oct 2 2012 12:28 AM |
HW_Web_dl.pdf |
PDF Document |
4.6 MB |
Oct 2 2012 12:27 AM |
IfanAgentKnocks.pdf |
PDF Document |
17 KB |
Oct 2 2012 12:34 AM |
If You Tolerate This....htm |
HTML File |
16.8 KB |
Oct 2 2012 12:28 AM |
Igniting the Spark - An Interview With David Duke.htm |
HTML File |
30.5 KB |
Oct 2 2012 12:29 AM |
IHRLeaflets.pdf |
PDF Document |
284.6 KB |
Oct 2 2012 12:28 AM |
IHRupdate_November_2005.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:30 AM |
ij01.html |
HTML File |
32.3 KB |
Oct 2 2012 12:28 AM |
ij02.html |
HTML File |
19.7 KB |
Oct 2 2012 12:28 AM |
ij03.html |
HTML File |
20.7 KB |
Oct 2 2012 12:32 AM |
ij04.html |
HTML File |
24.3 KB |
Oct 2 2012 12:33 AM |
ij05.html |
HTML File |
29.5 KB |
Oct 2 2012 12:27 AM |
ij06.html |
HTML File |
15.6 KB |
Oct 2 2012 12:31 AM |
ij07.html |
HTML File |
17.4 KB |
Oct 2 2012 12:28 AM |
ij08.html |
HTML File |
24.9 KB |
Oct 2 2012 12:28 AM |
ij09.html |
HTML File |
26.8 KB |
Oct 2 2012 12:33 AM |
ij10.html |
HTML File |
17.7 KB |
Oct 2 2012 12:29 AM |
ij11.html |
HTML File |
25.1 KB |
Oct 2 2012 12:33 AM |
ij12.html |
HTML File |
26.2 KB |
Oct 2 2012 12:28 AM |
ij13.html |
HTML File |
26.2 KB |
Oct 2 2012 12:32 AM |
ij14.html |
HTML File |
23 KB |
Oct 2 2012 12:28 AM |
ij15.html |
HTML File |
25.6 KB |
Oct 2 2012 12:32 AM |
ij16.html |
HTML File |
26.2 KB |
Oct 2 2012 12:31 AM |
ij17.html |
HTML File |
31 KB |
Oct 2 2012 12:29 AM |
ij18.html |
HTML File |
23.8 KB |
Oct 2 2012 12:28 AM |
ij19.html |
HTML File |
24.3 KB |
Oct 2 2012 12:29 AM |
ij20.html |
HTML File |
24.8 KB |
Oct 2 2012 12:30 AM |
ij21.html |
HTML File |
24.8 KB |
Oct 2 2012 12:28 AM |
ij22.html |
HTML File |
24.1 KB |
Oct 2 2012 12:33 AM |
ij23.html |
HTML File |
25.1 KB |
Oct 2 2012 12:32 AM |
ij24.html |
HTML File |
25.5 KB |
Oct 2 2012 12:27 AM |
ij25.html |
HTML File |
24.1 KB |
Oct 2 2012 12:28 AM |
ij26.html |
HTML File |
21.5 KB |
Oct 2 2012 12:31 AM |
ij27.html |
HTML File |
25.7 KB |
Oct 2 2012 12:30 AM |
ij28.html |
HTML File |
22.7 KB |
Oct 2 2012 12:31 AM |
ij29.html |
HTML File |
16.9 KB |
Oct 2 2012 12:30 AM |
ij30.html |
HTML File |
20.1 KB |
Oct 2 2012 12:31 AM |
ij31.html |
HTML File |
21.3 KB |
Oct 2 2012 12:28 AM |
ij32.html |
HTML File |
22.1 KB |
Oct 2 2012 12:32 AM |
ij33.html |
HTML File |
24.9 KB |
Oct 2 2012 12:33 AM |
ij34.html |
HTML File |
24.2 KB |
Oct 2 2012 12:29 AM |
ij35.html |
HTML File |
28.1 KB |
Oct 2 2012 12:31 AM |
ij36.html |
HTML File |
25.4 KB |
Oct 2 2012 12:29 AM |
ij37.html |
HTML File |
4.5 KB |
Oct 2 2012 12:31 AM |
ij38.html |
HTML File |
15.9 KB |
Oct 2 2012 12:33 AM |
ij39.html |
HTML File |
7.5 KB |
Oct 2 2012 12:33 AM |
ij40.html |
HTML File |
25.9 KB |
Oct 2 2012 12:30 AM |
ij41.html |
HTML File |
26.8 KB |
Oct 2 2012 12:31 AM |
ij42.html |
HTML File |
25.2 KB |
Oct 2 2012 12:31 AM |
ij43.html |
HTML File |
28 KB |
Oct 2 2012 12:33 AM |
ij44.html |
HTML File |
29.7 KB |
Oct 2 2012 12:30 AM |
ij45.html |
HTML File |
29 KB |
Oct 2 2012 12:31 AM |
ij46.html |
HTML File |
26.3 KB |
Oct 2 2012 12:29 AM |
ij47.html |
HTML File |
22.8 KB |
Oct 2 2012 12:33 AM |
ij48.html |
HTML File |
26.6 KB |
Oct 2 2012 12:33 AM |
ij49.html |
HTML File |
26.8 KB |
Oct 2 2012 12:32 AM |
ij50.html |
HTML File |
23.5 KB |
Oct 2 2012 12:31 AM |
ij51.html |
HTML File |
27.9 KB |
Oct 2 2012 12:30 AM |
ij52.html |
HTML File |
25.6 KB |
Oct 2 2012 12:31 AM |
ij53.html |
HTML File |
25.9 KB |
Oct 2 2012 12:32 AM |
ij54.html |
HTML File |
24.7 KB |
Oct 2 2012 12:31 AM |
ij55.html |
HTML File |
24.3 KB |
Oct 2 2012 12:33 AM |
ij56.html |
HTML File |
23.8 KB |
Oct 2 2012 12:31 AM |
ij57.html |
HTML File |
26.3 KB |
Oct 2 2012 12:27 AM |
ij58.html |
HTML File |
25.4 KB |
Oct 2 2012 12:33 AM |
ij59.html |
HTML File |
24.6 KB |
Oct 2 2012 12:33 AM |
ij60.html |
HTML File |
26.1 KB |
Oct 2 2012 12:28 AM |
ij61.html |
HTML File |
27.6 KB |
Oct 2 2012 12:28 AM |
ij62.html |
HTML File |
25.2 KB |
Oct 2 2012 12:31 AM |
ij63.html |
HTML File |
24.6 KB |
Oct 2 2012 12:31 AM |
ij64.html |
HTML File |
20.6 KB |
Oct 2 2012 12:33 AM |
ij65.html |
HTML File |
26.2 KB |
Oct 2 2012 12:33 AM |
ij66.html |
HTML File |
26.5 KB |
Oct 2 2012 12:28 AM |
ij67.html |
HTML File |
27.3 KB |
Oct 2 2012 12:33 AM |
ij68.html |
HTML File |
27.6 KB |
Oct 2 2012 12:28 AM |
ij69.html |
HTML File |
28 KB |
Oct 2 2012 12:31 AM |
ij70.html |
HTML File |
23.6 KB |
Oct 2 2012 12:33 AM |
ij71.html |
HTML File |
23.9 KB |
Oct 2 2012 12:28 AM |
ij72.html |
HTML File |
21.1 KB |
Oct 2 2012 12:32 AM |
ij73.html |
HTML File |
25.3 KB |
Oct 2 2012 12:30 AM |
ij74.html |
HTML File |
22 KB |
Oct 2 2012 12:30 AM |
ij75.html |
HTML File |
25.3 KB |
Oct 2 2012 12:34 AM |
ij76.html |
HTML File |
26 KB |
Oct 2 2012 12:30 AM |
ij77.html |
HTML File |
29.2 KB |
Oct 2 2012 12:30 AM |
ij78.html |
HTML File |
29.2 KB |
Oct 2 2012 12:31 AM |
ij79.html |
HTML File |
23.7 KB |
Oct 2 2012 12:34 AM |
ij80.html |
HTML File |
24.3 KB |
Oct 2 2012 12:34 AM |
Illegal Immigration - War with Mexico Approaches.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:28 AM |
Illegal Immigration and the Racism of 'Antiracism'.htm |
HTML File |
15.8 KB |
Oct 2 2012 12:31 AM |
IllegalImmigrationMyths.pdf |
PDF Document |
75.3 KB |
Oct 2 2012 12:34 AM |
Illegal Immigration Sparks Race War in Cities, Prisions.htm |
HTML File |
7.8 KB |
Oct 2 2012 12:30 AM |
Illegals Demand the 'Right' to Break the Law.htm |
HTML File |
6.7 KB |
Oct 2 2012 12:33 AM |
Illinois Cops - Arabs Beat, Gas Black.htm |
HTML File |
4 KB |
Oct 2 2012 12:27 AM |
immigrationmustcease.pdf |
PDF Document |
109.7 KB |
Oct 2 2012 12:32 AM |
imperium-pdf.zip |
ZIP Archive |
1.3 MB |
Oct 2 2012 12:28 AM |
imperium.css |
Stylesheet |
758 Bytes |
Oct 2 2012 12:32 AM |
imperium.zip |
ZIP Archive |
510.3 KB |
Oct 2 2012 12:29 AM |
Imperium103.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:30 AM |
InDefenseOfRacism.pdf |
PDF Document |
288 KB |
Oct 2 2012 12:32 AM |
indexfiles.html |
HTML File |
15 KB |
Oct 2 2012 12:27 AM |
Indian Schools, Genes, Assimilation, and Illegal Aliens.htm |
HTML File |
15.9 KB |
Oct 2 2012 12:33 AM |
Indians Reject Black Claims.htm |
HTML File |
6.3 KB |
Oct 2 2012 12:31 AM |
Indicted - Republican Corporate Whore DeLay Resigns.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:31 AM |
infamy.pdf |
PDF Document |
313.3 KB |
Oct 2 2012 12:31 AM |
Infected Africans Skyrocket AIDS-HIV in Croydon, London.htm |
HTML File |
1.8 KB |
Oct 2 2012 12:31 AM |
In Italy, Al Qaeda Turns to Organized Crime for Protection.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:31 AM |
In Praise of Saudi Arabia.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:28 AM |
Institute for Political & International Studies.htm |
HTML File |
17 KB |
Oct 2 2012 12:32 AM |
InternationalJew.pdf |
PDF Document |
3.1 MB |
Oct 2 2012 12:29 AM |
InternationalJew.rtf |
RTF File |
2.2 MB |
Oct 2 2012 12:29 AM |
Interracial Rape Victim - Called by God to 'Minister Against Racism'.htm |
HTML File |
7.2 KB |
Oct 2 2012 12:28 AM |
Interview with the Grim Reaper - StantonReaper0905.htm |
HTML File |
16.8 KB |
Oct 2 2012 12:32 AM |
intro - National Vanguard.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:32 AM |
Intro.htm |
HTML File |
17.1 KB |
Oct 2 2012 12:28 AM |
intro.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:29 AM |
Introducing the Global I.D. Card.htm |
HTML File |
2 KB |
Oct 2 2012 12:31 AM |
introduction.html |
HTML File |
9.2 KB |
Oct 2 2012 12:34 AM |
Invasion.pdf |
PDF Document |
27 KB |
Oct 2 2012 12:33 AM |
Iran - The 'Holocaust' Threat to World Peace.htm |
HTML File |
22.3 KB |
Oct 2 2012 12:34 AM |
Iranians Produce Holocaust Cartoons.htm |
HTML File |
5 KB |
Oct 2 2012 12:32 AM |
Iraq - Christians Leery of Islamic 'Tolerance'.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
Iraq at the Gates of Hell.htm |
HTML File |
37.8 KB |
Oct 2 2012 12:32 AM |
IraqGassingLies.pdf |
PDF Document |
81.1 KB |
Oct 2 2012 12:30 AM |
Iraqi Resister - Black Soldiers are Targets.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:31 AM |
irish.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:27 AM |
Irish Academics Urge Israel Boycott.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:31 AM |
IronHeel.pdf |
PDF Document |
557.4 KB |
Oct 2 2012 12:28 AM |
Irreconcilable Differences.htm |
HTML File |
152.5 KB |
Oct 2 2012 12:32 AM |
irving.html |
HTML File |
24.9 KB |
Oct 2 2012 12:34 AM |
Is any of this stuff made in Israel.htm |
HTML File |
30.7 KB |
Oct 2 2012 12:28 AM |
Is Europe Unable to Assimilate Its Growing Islamic Minority.htm |
HTML File |
10.8 KB |
Oct 2 2012 12:30 AM |
Islamic Headscarf Ban Debate Hits Australia.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:31 AM |
Islamic Wisdom - 'Rapist' Jailed, 'Victim' Executed.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:27 AM |
Islamists Throng in Europe's Powder Keg.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:33 AM |
Islam versus Christianity – A reply to The Pope!.htm |
HTML File |
58.8 KB |
Oct 2 2012 12:33 AM |
Is Neocon Spokesman Soliciting Murder of David Duke.htm |
HTML File |
6.9 KB |
Oct 2 2012 12:32 AM |
Israel's End Game Gambit Failure_ Hamas Refuses to Allow Israel to Exist.html |
HTML File |
63.2 KB |
Oct 2 2012 12:32 AM |
Israel's Interior Minister - 'Stop Spitting on Christians'.htm |
HTML File |
8 KB |
Oct 2 2012 12:29 AM |
Israel's Secret Weapon.htm |
HTML File |
43 KB |
Oct 2 2012 12:33 AM |
Israel's Sex-Slave Industry Soars.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:28 AM |
Israel - Beyond Good and Evil.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:27 AM |
Israel - New Party Urges Expulsion of Non-Jews.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:32 AM |
Israel - Poll Shows 64 Percent of Israeli Jews Favor Ethnic Cleansing.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:29 AM |
Israel - Was BBC's Peter Hounam Arrested as Punishment.htm |
HTML File |
4.7 KB |
Oct 2 2012 12:33 AM |
israel.pdf |
PDF Document |
531.8 KB |
Oct 2 2012 12:30 AM |
Israel Honors Jewish Terrorists Who Attacked America.htm |
HTML File |
17.3 KB |
Oct 2 2012 12:31 AM |
Israeli-Sponsored Educational Program for NY Schools.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:31 AM |
israeliespionageandillegaltechnologyretransfer.html |
HTML File |
11.1 KB |
Oct 2 2012 12:27 AM |
Israeli Gangster Shot Dead in Russia.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:28 AM |
Israeli Minister Calls for Nasrallah's Death.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:33 AM |
Israel in Hot Water Over New Zealand Spies.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:28 AM |
Israeli Nuclear Whistleblower Vanunu Speaks.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:29 AM |
Israeli PM's party plagiarizes from Texas Democrats.htm |
HTML File |
22.8 KB |
Oct 2 2012 12:32 AM |
IsraeliPrimeMinisterDeclaresJewWarOnIranAndSyria.html |
HTML File |
28.1 KB |
Oct 2 2012 12:32 AM |
Israelis Among the Holocaust Deniers.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:32 AM |
Israeli Sexpionage - The McGreevey, Condit and Clinton Affairs.htm |
HTML File |
12.4 KB |
Oct 2 2012 12:34 AM |
Israelis Launch Voting Guide.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:31 AM |
Israeli Sniper Assassinates Two Children.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:27 AM |
Israeli Spying - The Mother of All Scandals.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:30 AM |
Israelis Win Contract To Secure US Borders.htm |
HTML File |
22.1 KB |
Oct 2 2012 12:28 AM |
Israeli troops seize million dollars in bank raids across West Bank.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:33 AM |
Israeli Website Exposes Jewish Extremism!.htm |
HTML File |
13 KB |
Oct 2 2012 12:29 AM |
Israel Loan Program Limited to Jews.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:32 AM |
IsraelLobbyAndUSForeignPolicy.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:30 AM |
Israel Lobby Denial.htm |
HTML File |
14.1 KB |
Oct 2 2012 12:31 AM |
Israel Pushing U.S. to Bomb Iran.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:32 AM |
IsraelSexSlaveTrade.pdf |
PDF Document |
50.9 KB |
Oct 2 2012 12:28 AM |
IsraelSexSlaveTraffic.pdf |
PDF Document |
956 KB |
Oct 2 2012 12:27 AM |
israelsuspectedoftransferringuslaserweapondatatochina.html |
HTML File |
7.9 KB |
Oct 2 2012 12:33 AM |
israelviolatesrulesonmissilesales.html |
HTML File |
5.4 KB |
Oct 2 2012 12:34 AM |
Israel Wants IAEA to Ignore its Nuclear Arsenal, Concentrate on Iran.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:28 AM |
israelweapons.pdf |
PDF Document |
133.8 KB |
Oct 2 2012 12:30 AM |
israelweapons.rtf |
RTF File |
194.5 KB |
Oct 2 2012 12:31 AM |
Israel Will Continue to Hurl Terror Bombs into Gaza Homes, Producing Wounded and Dying Children.html |
HTML File |
44.7 KB |
Oct 2 2012 12:27 AM |
Is There Some Bravery Left in Braveheart.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:31 AM |
It's 1984 in Massachusetts – And Big Brother Is Gay.htm |
HTML File |
15.5 KB |
Oct 2 2012 12:30 AM |
It's Coming to America, Too.htm |
HTML File |
6.2 KB |
Oct 2 2012 12:33 AM |
It's the Genes, Stupid!.htm |
HTML File |
21.8 KB |
Oct 2 2012 12:31 AM |
its_a_deal.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:27 AM |
I Was Israel’s Dupe.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:28 AM |
iwc4jan.mp3 |
MP3 Audio |
3.5 MB |
Oct 2 2012 12:33 AM |
I Wonder What The Tiger Thinks.rtf |
RTF File |
3.2 KB |
Oct 2 2012 12:31 AM |
izterrorfile.pdf |
PDF Document |
783 KB |
Oct 2 2012 12:34 AM |
izterrorfile.rtf |
RTF File |
515.3 KB |
Oct 2 2012 12:33 AM |
IzzySecretServicesTruth.rtf |
RTF File |
66.7 KB |
Oct 2 2012 12:32 AM |
IzzySpyRing.pdf |
PDF Document |
2 MB |
Oct 2 2012 12:30 AM |
jackson-report.pdf |
PDF Document |
719 KB |
Oct 2 2012 12:32 AM |
Jagger Rejects Kabbalah after Extortion Attempt.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:29 AM |
James and Cindy; Progress and Hope.htm |
HTML File |
22.6 KB |
Oct 2 2012 12:31 AM |
Jan01.pdf |
PDF Document |
747.2 KB |
Oct 2 2012 12:28 AM |
Jan02.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:28 AM |
Jan03.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:32 AM |
Jan04.pdf |
PDF Document |
917.6 KB |
Oct 2 2012 12:27 AM |
Janis Ian - 2002-09-16 - THE INTERNET DEBACLE – AN ALTERNATIVE VIEW.htm |
HTML File |
32.8 KB |
Oct 2 2012 12:32 AM |
jaws.pdf |
PDF Document |
320.7 KB |
Oct 2 2012 12:33 AM |
JB Cash - 2006-01-05 - Death of a Hero.htm |
HTML File |
20.5 KB |
Oct 2 2012 12:29 AM |
J Dub Gettin’ Funky in Durham.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:32 AM |
Jeff A. Taylor - 2006-07-24 - Rah-Rah IDF.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:31 AM |
Jerry Falwell Now Supports 'Gay' Rights.htm |
HTML File |
5 KB |
Oct 2 2012 12:34 AM |
jew-archives-previous-latest-additions.htm |
HTML File |
5 KB |
Oct 2 2012 12:29 AM |
jew-atrocities-blackmail_of_nations.html |
HTML File |
2.1 KB |
Oct 2 2012 12:28 AM |
jew-atrocities-egypt1967.html |
HTML File |
25.3 KB |
Oct 2 2012 12:31 AM |
jew-atrocities-folder.html |
HTML File |
4.1 KB |
Oct 2 2012 12:33 AM |
jew-atrocities-hebron.html |
HTML File |
20.4 KB |
Oct 2 2012 12:29 AM |
jew-atrocities-intifada.html |
HTML File |
20.6 KB |
Oct 2 2012 12:30 AM |
jew-atrocities-iraq.html |
HTML File |
15.9 KB |
Oct 2 2012 12:31 AM |
jew-atrocities-israelitorture.htm |
HTML File |
31.8 KB |
Oct 2 2012 12:34 AM |
jew-atrocities-jewsagainstjews.html |
HTML File |
3.5 KB |
Oct 2 2012 12:31 AM |
jew-atrocities-lebanon.html |
HTML File |
76 KB |
Oct 2 2012 12:31 AM |
jew-atrocities-political-correctness-crimes.html |
HTML File |
5.4 KB |
Oct 2 2012 12:34 AM |
jew-atrocities-slaves-jewish-slave-ship-owners.html |
HTML File |
5.8 KB |
Oct 2 2012 12:28 AM |
jew-atrocities-slaves.html |
HTML File |
7.1 KB |
Oct 2 2012 12:34 AM |
jew-communists-HUAC-Lists.htm |
HTML File |
80.4 KB |
Oct 2 2012 12:27 AM |
jew-communists-joe-mccarthy-and-the-jews.html |
HTML File |
42.9 KB |
Oct 2 2012 12:33 AM |
jew-communists-rothschild-banks.html |
HTML File |
53.4 KB |
Oct 2 2012 12:31 AM |
jew-communists.html |
HTML File |
30.4 KB |
Oct 2 2012 12:31 AM |
jew-crime-mob-russia-ussr.html |
HTML File |
101.6 KB |
Oct 2 2012 12:33 AM |
jew-criminalsandspies-bentley.html |
HTML File |
4.1 KB |
Oct 2 2012 12:31 AM |
jew-criminalsandspies-elitcher-max.html |
HTML File |
4.1 KB |
Oct 2 2012 12:30 AM |
jew-criminalsandspies-feklisov.html |
HTML File |
4.9 KB |
Oct 2 2012 12:31 AM |
jew-criminalsandspies-folder.html |
HTML File |
4.4 KB |
Oct 2 2012 12:30 AM |
jew-criminalsandspies-fuchs.html |
HTML File |
6.4 KB |
Oct 2 2012 12:33 AM |
jew-criminalsandspies-gold.html |
HTML File |
4.2 KB |
Oct 2 2012 12:30 AM |
jew-criminalsandspies-greenglass-wife.html |
HTML File |
4 KB |
Oct 2 2012 12:34 AM |
jew-criminalsandspies-greenglass.html |
HTML File |
5.3 KB |
Oct 2 2012 12:27 AM |
jew-criminalsandspies-hall.html |
HTML File |
23.4 KB |
Oct 2 2012 12:31 AM |
jew-criminalsandspies-oppenheimer-robert.html |
HTML File |
10.7 KB |
Oct 2 2012 12:30 AM |
jew-criminalsandspies-perl.html |
HTML File |
5.5 KB |
Oct 2 2012 12:33 AM |
jew-criminalsandspies-pollard.html |
HTML File |
2.9 KB |
Oct 2 2012 12:30 AM |
jew-criminalsandspies-rosenberg.html |
HTML File |
3.8 KB |
Oct 2 2012 12:32 AM |
jew-criminalsandspies-sobell.html |
HTML File |
27.4 KB |
Oct 2 2012 12:29 AM |
jew-criminalsandspies-vanunu.html |
HTML File |
19.1 KB |
Oct 2 2012 12:28 AM |
jew-genocide-black-holocaust-abolition-myth.html |
HTML File |
19.8 KB |
Oct 2 2012 12:27 AM |
jew-genocide-gentilehate.html |
HTML File |
19 KB |
Oct 2 2012 12:30 AM |
jew-genocide-palestinian-qana.htm |
HTML File |
18 KB |
Oct 2 2012 12:32 AM |
jew-genocide-USSRchristians-antisemitismcrime.html |
HTML File |
6 KB |
Oct 2 2012 12:28 AM |
jew-genocide-USSRchristians-JAC.html |
HTML File |
3.9 KB |
Oct 2 2012 12:30 AM |
jew-jewishbankingandfinancialmanipulations-folder.html |
HTML File |
26.4 KB |
Oct 2 2012 12:33 AM |
jew-jewishbankingandfinancialmanipulations-food-companies.html |
HTML File |
9.6 KB |
Oct 2 2012 12:29 AM |
jew-jewishbankingandfinancialmanipulations-islam-off-dow-jones.html |
HTML File |
19.7 KB |
Oct 2 2012 12:28 AM |
jew-jewishbankingandfinancialmanipulations-mcfadden-speech.html |
HTML File |
104.4 KB |
Oct 2 2012 12:31 AM |
jew-jewishbankingandfinancialmanipulations-secretsofthefederalreservebyeustace mullins.html |
HTML File |
602.7 KB |
Oct 2 2012 12:32 AM |
jew-jewishsupremacyassociationsmovements-art-organizations.html |
HTML File |
7.2 KB |
Oct 2 2012 12:32 AM |
jew-jewishsupremacyassociationsmovements-associations.html |
HTML File |
108.2 KB |
Oct 2 2012 12:28 AM |
jew-jewishsupremacyassociationsmovements-cultural-ethnic-associations.html |
HTML File |
14.6 KB |
Oct 2 2012 12:33 AM |
jew-jewishsupremacyassociationsmovements-environment-movements.html |
HTML File |
7 KB |
Oct 2 2012 12:28 AM |
jew-jewishsupremacyassociationsmovements-family-women-sex-gender-issues.html |
HTML File |
13.4 KB |
Oct 2 2012 12:33 AM |
jew-jewishsupremacyassociationsmovements-folder.html |
HTML File |
5.1 KB |
Oct 2 2012 12:33 AM |
jew-jewishsupremacyassociationsmovements-foundations-grants-orgs.html |
HTML File |
7.7 KB |
Oct 2 2012 12:30 AM |
jew-jewishsupremacyassociationsmovements-hate-genocide.html |
HTML File |
7.5 KB |
Oct 2 2012 12:31 AM |
jew-jewishsupremacyassociationsmovements-immigration.html |
HTML File |
6.5 KB |
Oct 2 2012 12:30 AM |
jew-jewishsupremacyassociationsmovements-law-rights.html |
HTML File |
11.8 KB |
Oct 2 2012 12:31 AM |
jew-jewishsupremacyassociationsmovements-mass-media-associations.html |
HTML File |
17.1 KB |
Oct 2 2012 12:28 AM |
jew-jewishsupremacyassociationsmovements-money-business-organizations.html |
HTML File |
15 KB |
Oct 2 2012 12:27 AM |
jew-jewishsupremacyassociationsmovements-politics.html |
HTML File |
22.4 KB |
Oct 2 2012 12:27 AM |
jew-jewishsupremacyassociationsmovements-religious.html |
HTML File |
10.9 KB |
Oct 2 2012 12:28 AM |
jew-jewishsupremacyassociationsmovements-think-tanks-others.html |
HTML File |
12.6 KB |
Oct 2 2012 12:31 AM |
jew-jewishsupremacyassociationsmovements-unions-occupations-others.html |
HTML File |
16.4 KB |
Oct 2 2012 12:29 AM |
jew-jewishsupremacyassociationsmovements-universities.html |
HTML File |
18.4 KB |
Oct 2 2012 12:31 AM |
jew-leaders-attorneys.html |
HTML File |
3 KB |
Oct 2 2012 12:29 AM |
jew-leaders-begin.html |
HTML File |
9 KB |
Oct 2 2012 12:33 AM |
jew-leaders-ben-gurion.html |
HTML File |
87.2 KB |
Oct 2 2012 12:30 AM |
jew-leaders-churchill.html |
HTML File |
6 KB |
Oct 2 2012 12:33 AM |
jew-leaders-dayan.html |
HTML File |
4.6 KB |
Oct 2 2012 12:27 AM |
jew-leaders-eisenhower.html |
HTML File |
7.4 KB |
Oct 2 2012 12:31 AM |
jew-leaders-executives.html |
HTML File |
3.7 KB |
Oct 2 2012 12:28 AM |
jew-leaders-famousjewslist.html |
HTML File |
15.6 KB |
Oct 2 2012 12:30 AM |
jew-leaders-folder.html |
HTML File |
9.3 KB |
Oct 2 2012 12:34 AM |
jew-leaders-frank.html |
HTML File |
2.2 KB |
Oct 2 2012 12:29 AM |
jew-leaders-hertzl.html |
HTML File |
2.7 KB |
Oct 2 2012 12:28 AM |
jew-leaders-kaganovich.html |
HTML File |
45 KB |
Oct 2 2012 12:31 AM |
jew-leaders-kahane.html |
HTML File |
3.4 KB |
Oct 2 2012 12:34 AM |
jew-leaders-luxemberg.html |
HTML File |
24 KB |
Oct 2 2012 12:27 AM |
jew-leaders-mafia.html |
HTML File |
4.5 KB |
Oct 2 2012 12:30 AM |
jew-leaders-netanyahu.html |
HTML File |
3.1 KB |
Oct 2 2012 12:34 AM |
jew-leaders-rabin.html |
HTML File |
1.9 KB |
Oct 2 2012 12:31 AM |
jew-leaders-roosevelt.html |
HTML File |
5.7 KB |
Oct 2 2012 12:31 AM |
jew-leaders-rothschild.html |
HTML File |
5.1 KB |
Oct 2 2012 12:31 AM |
jew-leaders-stalin.html |
HTML File |
7.3 KB |
Oct 2 2012 12:32 AM |
jew-leaders-trotsky.htm |
HTML File |
6.5 KB |
Oct 2 2012 12:30 AM |
jew-leaders-ussr-pm-yevgeny-primakov.html |
HTML File |
3.6 KB |
Oct 2 2012 12:31 AM |
jew-leaders-yagoda.html |
HTML File |
5 KB |
Oct 2 2012 12:32 AM |
jew-mafia.htm |
HTML File |
26 KB |
Oct 2 2012 12:33 AM |
jew-mindcontrol-anarchism.html |
HTML File |
12.1 KB |
Oct 2 2012 12:29 AM |
jew-mindcontrol-atheism.html |
HTML File |
87.9 KB |
Oct 2 2012 12:30 AM |
jew-mindcontrol-civil-rights.html |
HTML File |
9.4 KB |
Oct 2 2012 12:30 AM |
jew-mindcontrol-communism.html |
HTML File |
8.3 KB |
Oct 2 2012 12:27 AM |
jew-mindcontrol-feminism.html |
HTML File |
25.4 KB |
Oct 2 2012 12:30 AM |
jew-mindcontrol-folder.html |
HTML File |
3.8 KB |
Oct 2 2012 12:29 AM |
jew-mindcontrol-freudianism.html |
HTML File |
59.7 KB |
Oct 2 2012 12:33 AM |
jew-mindcontrol-homosexuality.html |
HTML File |
13.5 KB |
Oct 2 2012 12:28 AM |
jew-mindcontrol-immigration.html |
HTML File |
3.8 KB |
Oct 2 2012 12:33 AM |
jew-mindcontrol-liberalism.html |
HTML File |
5 KB |
Oct 2 2012 12:34 AM |
jew-mindcontrol-new-left.html |
HTML File |
319.3 KB |
Oct 2 2012 12:28 AM |
jew-occupiedgovernments-australia.html |
HTML File |
2.1 KB |
Oct 2 2012 12:29 AM |
jew-occupiedgovernments-austria.html |
HTML File |
3.7 KB |
Oct 2 2012 12:30 AM |
jew-occupiedgovernments-CIS.html |
HTML File |
2.5 KB |
Oct 2 2012 12:30 AM |
jew-occupiedgovernments-folder.html |
HTML File |
2.4 KB |
Oct 2 2012 12:32 AM |
jew-occupiedgovernments-france.html |
HTML File |
5.5 KB |
Oct 2 2012 12:31 AM |
jew-occupiedgovernments-germany-hitlers-jew-support.html |
HTML File |
13.2 KB |
Oct 2 2012 12:33 AM |
jew-occupiedgovernments-germany.html |
HTML File |
27.6 KB |
Oct 2 2012 12:32 AM |
jew-occupiedgovernments-israel-iq.html |
HTML File |
148.9 KB |
Oct 2 2012 12:33 AM |
jew-occupiedgovernments-israel.html |
HTML File |
46.7 KB |
Oct 2 2012 12:27 AM |
jew-occupiedgovernments-poland.html |
HTML File |
7.1 KB |
Oct 2 2012 12:28 AM |
jew-occupiedgovernments-uk.html |
HTML File |
11.7 KB |
Oct 2 2012 12:34 AM |
jew-occupiedgovernments-usa-sds.html |
HTML File |
17.1 KB |
Oct 2 2012 12:31 AM |
jew-occupiedgovernments-usa.html |
HTML File |
44.6 KB |
Oct 2 2012 12:30 AM |
jew-occupiedgovernments-USSR-historians.html |
HTML File |
19.6 KB |
Oct 2 2012 12:32 AM |
jew-occupiedgovernments-USSR-jewish-bolsheviks-answer.com.html |
HTML File |
34 KB |
Oct 2 2012 12:33 AM |
jew-occupiedgovernments-USSR-Jewish-Bolshevism-Bolsheviks.html |
HTML File |
58.4 KB |
Oct 2 2012 12:29 AM |
jew-occupiedgovernments-USSR-moreevidence - Historical Sources.htm |
HTML File |
36.4 KB |
Oct 2 2012 12:31 AM |
jew-occupiedgovernments-USSR-moreevidence.html |
HTML File |
35.7 KB |
Oct 2 2012 12:33 AM |
jew-occupiedgovernments-USSR-revolution.html |
HTML File |
8.9 KB |
Oct 2 2012 12:28 AM |
jew-occupiedgovernments-USSR-victim-email.html |
HTML File |
5.4 KB |
Oct 2 2012 12:33 AM |
jew-occupiedgovernments-USSR.html |
HTML File |
122.5 KB |
Oct 2 2012 12:34 AM |
jew-occupiedgovernments-vatican.html |
HTML File |
25.7 KB |
Oct 2 2012 12:32 AM |
jew-organizations-ACLU.html |
HTML File |
2.9 KB |
Oct 2 2012 12:32 AM |
jew-organizations-ADL.html |
HTML File |
190.4 KB |
Oct 2 2012 12:33 AM |
jew-organizations-AIPAC.html |
HTML File |
8.1 KB |
Oct 2 2012 12:33 AM |
jew-organizations-bnaibrith.html |
HTML File |
30 KB |
Oct 2 2012 12:28 AM |
jew-organizations-folder.html |
HTML File |
3.8 KB |
Oct 2 2012 12:28 AM |
jew-organizations-JDL-Zionist-Terror-Network-IHR.htm |
HTML File |
107.4 KB |
Oct 2 2012 12:27 AM |
jew-organizations-JDL.html |
HTML File |
3.1 KB |
Oct 2 2012 12:28 AM |
jew-organizations-jewishbund.html |
HTML File |
4.3 KB |
Oct 2 2012 12:29 AM |
jew-organizations-NAACP.html |
HTML File |
5.2 KB |
Oct 2 2012 12:29 AM |
jew-organizations-NOW.html |
HTML File |
3.8 KB |
Oct 2 2012 12:32 AM |
jew-organizations-penetration-white-european-orgs.html |
HTML File |
14.3 KB |
Oct 2 2012 12:28 AM |
jew-organizations-splc.html |
HTML File |
12.7 KB |
Oct 2 2012 12:27 AM |
jew-organizations-wiesenthal.html |
HTML File |
147 KB |
Oct 2 2012 12:31 AM |
jew-organizations-WZO.html |
HTML File |
10.4 KB |
Oct 2 2012 12:31 AM |
jew-radio-folder.html |
HTML File |
11.7 KB |
Oct 2 2012 12:32 AM |
jew-references-blogs.html |
HTML File |
13.8 KB |
Oct 2 2012 12:34 AM |
jew-references-daskapital.html |
HTML File |
3.7 KB |
Oct 2 2012 12:31 AM |
jew-references-gentile-whatotherssay - What world famous men said about the Jews.htm |
HTML File |
86.4 KB |
Oct 2 2012 12:33 AM |
jew-religions-judaism.html |
HTML File |
2.9 KB |
Oct 2 2012 12:31 AM |
jew-religions-millenium.html |
HTML File |
6.3 KB |
Oct 2 2012 12:33 AM |
jew-terrorists-aipac-pentagon.html |
HTML File |
3.5 KB |
Oct 2 2012 12:27 AM |
jew-terrorists-folder.html |
HTML File |
5.1 KB |
Oct 2 2012 12:31 AM |
jew-terrorists-jewish-zionist-terrorists.html |
HTML File |
14.8 KB |
Oct 2 2012 12:32 AM |
jew-terrorists-mossad.html |
HTML File |
80.4 KB |
Oct 2 2012 12:30 AM |
jew-terrorists-shin_bet.html |
HTML File |
14.6 KB |
Oct 2 2012 12:31 AM |
jew-usenet.html |
HTML File |
2.1 KB |
Oct 2 2012 12:28 AM |
jew1.jpg |
JPEG Image |
46.2 KB |
Oct 2 2012 12:33 AM |
jew2.jpg |
JPEG Image |
52.8 KB |
Oct 2 2012 12:34 AM |
jewbrain.jpg |
JPEG Image |
33.1 KB |
Oct 2 2012 12:29 AM |
JewDefectorWarnAmerica.pdf |
PDF Document |
31.8 KB |
Oct 2 2012 12:32 AM |
JewExpulsions.pdf |
PDF Document |
16.9 KB |
Oct 2 2012 12:28 AM |
jewface.exe |
DOS/WIN Executable |
10.5 MB |
Oct 2 2012 12:27 AM |
JewImmigrationPolicy.pdf |
PDF Document |
163.5 KB |
Oct 2 2012 12:34 AM |
Jewish 'Muslim' Threatens West with Genocide.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:27 AM |
Jewish Academic Blasts Middle-class Whites for Not 'Integrating' Kids.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:31 AM |
Jewish Anti-Gentile Hatred in Porn Industry.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:29 AM |
Jewish Censors Seek to Ban Dissident White Historian.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:33 AM |
JEWISH CRIME.htm |
HTML File |
125.8 KB |
Oct 2 2012 12:27 AM |
Jewish Genetic Diseases.htm |
HTML File |
39.5 KB |
Oct 2 2012 12:32 AM |
Jewish Genetic Diseases 2.htm |
HTML File |
25.8 KB |
Oct 2 2012 12:31 AM |
Jewish Hate, the Media, and the ADL.htm |
HTML File |
23.1 KB |
Oct 2 2012 12:31 AM |
JewishHistoryJewishReligion.pdf |
PDF Document |
420.7 KB |
Oct 2 2012 12:28 AM |
jewish involvement in immigration.pdf |
PDF Document |
191.7 KB |
Oct 2 2012 12:31 AM |
Jewish Lawyer Edward Fagan to Sue African Marxists.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:29 AM |
Jewish Leader Calls On Zionists To Kill All Palestinian Males.htm |
HTML File |
25.4 KB |
Oct 2 2012 12:31 AM |
Jewish Mafia Expands White Slave Trade to London.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:30 AM |
Jewish Porn King May Have Skipped to Israel.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:31 AM |
Jewish rabbi calls for extermination of all Palestinian males.htm |
HTML File |
7.2 KB |
Oct 2 2012 12:33 AM |
JewishRitualMurder.pdf |
PDF Document |
301.7 KB |
Oct 2 2012 12:31 AM |
jewish stake in immigration.pdf |
PDF Document |
93.5 KB |
Oct 2 2012 12:30 AM |
Jewish Support for Open Borders - Is it Biological.htm |
HTML File |
8.8 KB |
Oct 2 2012 12:27 AM |
jewishsupremacism.pdf |
PDF Document |
3.3 MB |
Oct 2 2012 12:31 AM |
jewish supremacism preface.pdf |
PDF Document |
85 KB |
Oct 2 2012 12:33 AM |
Jewish Supremacist Michael Chertoff Named Head of Homeland Security.htm |
HTML File |
10.4 KB |
Oct 2 2012 12:31 AM |
Jewish Supremacists Shaping Election of UN Secretary General.htm |
HTML File |
9 KB |
Oct 2 2012 12:32 AM |
JewishTalmudOrg.PDF |
PDF Document |
1.1 MB |
Oct 2 2012 12:33 AM |
Jewish Terrorist Gets Prison.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:30 AM |
Jewish Usury and Finance Capital.htm |
HTML File |
39.8 KB |
Oct 2 2012 12:27 AM |
Jewish Voters Object to New Polling Place.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:33 AM |
Jewish Voters Object to New Polling Place2.htm |
HTML File |
7.3 KB |
Oct 2 2012 12:33 AM |
JewishWarOfSurvival.pdf |
PDF Document |
182.4 KB |
Oct 2 2012 12:31 AM |
Jewish WMD Whistleblower Vanunu Released But Not Free.htm |
HTML File |
10.2 KB |
Oct 2 2012 12:31 AM |
JewishWorldConquest.rtf |
RTF File |
125.9 KB |
Oct 2 2012 12:28 AM |
jewish_media_control.pdf |
PDF Document |
627.4 KB |
Oct 2 2012 12:33 AM |
jewish_supremacism.pdf |
PDF Document |
3.3 MB |
Oct 2 2012 12:32 AM |
jewquestion.pdf |
PDF Document |
706.1 KB |
Oct 2 2012 12:34 AM |
jewquestion.rtf |
RTF File |
381.2 KB |
Oct 2 2012 12:33 AM |
JewReligionInfluenceToday.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:33 AM |
JewRoleInBolshevikRevolution.pdf |
PDF Document |
119.3 KB |
Oct 2 2012 12:32 AM |
Jews - A Religious Community, a People, or a Race.htm |
HTML File |
5.9 KB |
Oct 2 2012 12:33 AM |
jews.html |
HTML File |
40 KB |
Oct 2 2012 12:32 AM |
jews.jpg |
JPEG Image |
21.5 KB |
Oct 2 2012 12:27 AM |
Jews Admit - Iran Is Israel’s “Greatest Threat”.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:31 AM |
JewsAndTheirLies.pdf |
PDF Document |
265.4 KB |
Oct 2 2012 12:31 AM |
Jews And Their Zionist Views.htm |
HTML File |
13.6 KB |
Oct 2 2012 12:30 AM |
JewsAtSteeringWheel.pdf |
PDF Document |
108.8 KB |
Oct 2 2012 12:28 AM |
jews beat Santa Clause.htm |
HTML File |
30.2 KB |
Oct 2 2012 12:33 AM |
jewsgermany.jpg |
JPEG Image |
261.5 KB |
Oct 2 2012 12:34 AM |
JewsIQ.pdf |
PDF Document |
1.7 MB |
Oct 2 2012 12:31 AM |
Jews Push Homosexual 'Reality' TV Shows.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:30 AM |
Jews Relentless In Pursuit of Internet Censorship.htm |
HTML File |
13.2 KB |
Oct 2 2012 12:34 AM |
Jew Threatens LA With New 9-11.htm |
HTML File |
7 KB |
Oct 2 2012 12:32 AM |
Jingle Jam Chaos Closes Minnesota Mall.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:28 AM |
John Barleycorn.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:30 AM |
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency.htm |
HTML File |
26.1 KB |
Oct 2 2012 12:33 AM |
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency.txt |
Text File |
18 KB |
Oct 2 2012 12:28 AM |
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution, continued.htm |
HTML File |
60.6 KB |
Oct 2 2012 12:27 AM |
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution.htm |
HTML File |
75.2 KB |
Oct 2 2012 12:33 AM |
John H. Campbell - The Moral Imperative of Our Future Evolution.htm |
HTML File |
108.1 KB |
Oct 2 2012 12:31 AM |
JohnJayJewel.pdf |
PDF Document |
102 KB |
Oct 2 2012 12:32 AM |
John Moffat - 2005-08-15 - How Whites Won and Lost a Continent.txt |
Text File |
14.9 KB |
Oct 2 2012 12:30 AM |
John Tyndall - An Anagogical View of Empire.htm |
HTML File |
8.5 KB |
Oct 2 2012 12:28 AM |
Journalist Held In Dungeon Of Filth.htm |
HTML File |
1.9 KB |
Oct 2 2012 12:28 AM |
joys.pdf |
PDF Document |
287.1 KB |
Oct 2 2012 12:32 AM |
JudaismInMusic.pdf |
PDF Document |
72.5 KB |
Oct 2 2012 12:31 AM |
judeadeclareswar.pdf |
PDF Document |
84.4 KB |
Oct 2 2012 12:31 AM |
Judea declares war on Germany.htm |
HTML File |
28.6 KB |
Oct 2 2012 12:31 AM |
Judeo-Fascism.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:27 AM |
Jul02.pdf |
PDF Document |
1.7 MB |
Oct 2 2012 12:34 AM |
Jul03.pdf |
PDF Document |
779.3 KB |
Oct 2 2012 12:34 AM |
Jul04.pdf |
PDF Document |
749.2 KB |
Oct 2 2012 12:33 AM |
July01.pdf |
PDF Document |
773.2 KB |
Oct 2 2012 12:28 AM |
Jun01.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:33 AM |
Jun02.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:29 AM |
Jun03.pdf |
PDF Document |
684.4 KB |
Oct 2 2012 12:31 AM |
Jun04.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:31 AM |
Jury Selection to Be Moved in Bloodbath Trial.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:33 AM |
JustificationOfTerror.pdf |
PDF Document |
13.1 KB |
Oct 2 2012 12:34 AM |
just_say_yes.pdf |
PDF Document |
753.4 KB |
Oct 2 2012 12:32 AM |
Kaballah Crazy!.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:30 AM |
Kabbalah Red String Market Threatened.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:31 AM |
Kalevala.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:31 AM |
Kathleen Christiso - 2006-09-12 - The Coming Collapse of Zionism.htm |
HTML File |
33 KB |
Oct 2 2012 12:30 AM |
Katrina, Iraq, and the Know-It-All Syndrome.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:34 AM |
Katrina - Neo-con Pals Rake in the Dough.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:32 AM |
Katrina and the Black Tsunami.htm |
HTML File |
29.1 KB |
Oct 2 2012 12:30 AM |
Katrina Black Tells Fox You Owe Him.htm |
HTML File |
5.2 KB |
Oct 2 2012 12:28 AM |
Katrina Evacuee Charged with Child Murder.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:31 AM |
Katrina Evacuees Binge on Cape Cod.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:28 AM |
Katrina Students Spark Constitutional Debate.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:29 AM |
Katrina Tensions - School Official Resigns over Remarks.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:27 AM |
Katrina Threatens Croatian-American Tradition.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:31 AM |
Katrina Threatens to Swamp Utah.htm |
HTML File |
5.6 KB |
Oct 2 2012 12:28 AM |
Katrina Unleashes HIV+ Horde.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:27 AM |
Katrina Victims Unwelcome in Some Towns.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:33 AM |
kdrebel.pdf |
PDF Document |
424.8 KB |
Oct 2 2012 12:31 AM |
kdrebel.rtf |
RTF File |
317.7 KB |
Oct 2 2012 12:28 AM |
Keitel.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:32 AM |
Kenya - Black Priest Kills White Roman Catholic Bishop.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:31 AM |
Kill a Cracker Day.htm |
HTML File |
2.2 KB |
Oct 2 2012 12:30 AM |
Kill Arabs, Cry Anti-Semitism.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:34 AM |
Killer Plays Race Card.htm |
HTML File |
6.9 KB |
Oct 2 2012 12:27 AM |
Kill the Christians.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:28 AM |
Kirkby TV Covers Reconquista.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:33 AM |
KKKChristmasCardDOUBLEfold.pdf |
PDF Document |
292.3 KB |
Oct 2 2012 12:31 AM |
KKKChristmasCardSINGLEfold.pdf |
PDF Document |
315.9 KB |
Oct 2 2012 12:34 AM |
Klassen.pdf |
PDF Document |
390.5 KB |
Oct 2 2012 12:30 AM |
KlassenCD-Insert.pdf |
PDF Document |
86.5 KB |
Oct 2 2012 12:33 AM |
KlassenCD-ReOrderForm.pdf |
PDF Document |
69.4 KB |
Oct 2 2012 12:30 AM |
KlassenCD-TrayLiner.pdf |
PDF Document |
578.4 KB |
Oct 2 2012 12:30 AM |
know_your_rights.pdf |
PDF Document |
7.6 KB |
Oct 2 2012 12:28 AM |
Kook Conspiracy Theories - Reject Them.htm |
HTML File |
11.4 KB |
Oct 2 2012 12:33 AM |
KosherFoodTax.pdf |
PDF Document |
3.5 MB |
Oct 2 2012 12:28 AM |
Kosovo - A Dangerous Cosmetic Salon.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:29 AM |
kp-3.pdf |
PDF Document |
2.2 MB |
Oct 2 2012 12:33 AM |
KULA.pdf |
PDF Document |
5.8 MB |
Oct 2 2012 12:27 AM |
Kurdish soldiers trained by Israelis.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:28 AM |
Lamb Gaede - 11-year-old White Girl Stands for Truth in California.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:31 AM |
Lambing Flat.htm |
HTML File |
8.9 KB |
Oct 2 2012 12:33 AM |
Land Of Dope And Jewry.htm |
HTML File |
22.5 KB |
Oct 2 2012 12:33 AM |
La Pauvre Petite - Schoolgirl abduction-murder rivets France.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:31 AM |
Lapdance King, Lawyer Indicted in 'Mafia' Probe.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:34 AM |
La Raza List of Corporate Traitors.htm |
HTML File |
9.1 KB |
Oct 2 2012 12:28 AM |
LatviaYearOfHorror.pdf |
PDF Document |
6.6 MB |
Oct 2 2012 12:31 AM |
Law Enforcement Embattled in New Orleans.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:31 AM |
leaderlessresistance.htm |
HTML File |
22.1 KB |
Oct 2 2012 12:28 AM |
LeaderlessResistance.pdf |
PDF Document |
53.4 KB |
Oct 2 2012 12:31 AM |
LearningAboutHomos.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:31 AM |
Leftist Violence Flares at Norwegian Election Event.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:33 AM |
leif_eriksson.pdf |
PDF Document |
395.2 KB |
Oct 2 2012 12:32 AM |
lemmingsrefusetoacceptfactsofracialdifferencesinintelligence.html |
HTML File |
4.3 KB |
Oct 2 2012 12:31 AM |
Letter - A Father Pleads for His Son's Future.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:34 AM |
Letter from Atlanta - The Seamy Gold Club Trial.htm |
HTML File |
20.4 KB |
Oct 2 2012 12:29 AM |
LeuchterReport.pdf |
PDF Document |
2.2 MB |
Oct 2 2012 12:30 AM |
Levithian.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:29 AM |
LFS-BOOK-6.2.pdf |
PDF Document |
797.5 KB |
Oct 2 2012 12:31 AM |
LFS - essential_prereading |
Unknown |
12.7 KB |
Oct 2 2012 12:30 AM |
LiarWeasel.pdf |
PDF Document |
62.8 KB |
Oct 2 2012 12:33 AM |
Libby - press_advisory_1028.pdf |
PDF Document |
34.3 KB |
Oct 2 2012 12:28 AM |
libby_indictment_28102005.pdf |
PDF Document |
152.6 KB |
Oct 2 2012 12:33 AM |
Liberating America From Israel.htm |
HTML File |
9.6 KB |
Oct 2 2012 12:33 AM |
LifeIn3rdReich.pdf |
PDF Document |
55.6 KB |
Oct 2 2012 12:28 AM |
LifeInHitlersGermany.pdf |
PDF Document |
446 KB |
Oct 2 2012 12:28 AM |
Light for Nations - A Short History of the Jews in the Modern World.txt |
Text File |
60 KB |
Oct 2 2012 12:32 AM |
lightningsun.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:33 AM |
lightningsun.rtf |
RTF File |
5.3 MB |
Oct 2 2012 12:28 AM |
links.html |
HTML File |
34.6 KB |
Oct 2 2012 12:28 AM |
Links Of White Interest.txt |
Text File |
4.9 KB |
Oct 2 2012 12:31 AM |
Linux+IPv6-HOWTO.pdf |
PDF Document |
769.1 KB |
Oct 2 2012 12:30 AM |
lipshit.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:30 AM |
Lisa Rad - 2006-02-15 - Fall of the Fourth Reich.htm |
HTML File |
50.7 KB |
Oct 2 2012 12:31 AM |
list-of-jews.htm |
HTML File |
464.7 KB |
Oct 2 2012 12:30 AM |
littlemary-mp3.ram |
RAM File |
67 Bytes |
Oct 2 2012 12:32 AM |
littlemary.mp3 |
MP3 Audio |
3.3 MB |
Oct 2 2012 12:32 AM |
London - Jewish Mafia Loses Three Soldiers.htm |
HTML File |
6.5 KB |
Oct 2 2012 12:27 AM |
London Mayor Challenges Suspension.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:28 AM |
Looking to Belong.htm |
HTML File |
6.5 KB |
Oct 2 2012 12:30 AM |
LordOfTheRings.pdf |
PDF Document |
13 MB |
Oct 2 2012 12:30 AM |
lost_boy.pdf |
PDF Document |
291 KB |
Oct 2 2012 12:33 AM |
lost_boy_2.pdf |
PDF Document |
328.3 KB |
Oct 2 2012 12:30 AM |
lotrlit.zip |
ZIP Archive |
1.5 MB |
Oct 2 2012 12:31 AM |
Louis Beam - Leaderless Resistance - 1983.pdf |
PDF Document |
53.4 KB |
Oct 2 2012 12:31 AM |
Louisiana - Town's First Black Police Chief Charged in Crack Probe.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:34 AM |
Louisiana National Guard Troops Watch Katrina from Iraq.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:33 AM |
Louisiana Senator Threatens To Assault Bush.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:30 AM |
love-your-race.pdf |
PDF Document |
281 KB |
Oct 2 2012 12:29 AM |
Low-paid illegal work force has little impact on prices - 2.htm |
HTML File |
33.1 KB |
Oct 2 2012 12:33 AM |
Low-paid illegal work force has little impact on prices.htm |
HTML File |
12.3 KB |
Oct 2 2012 12:31 AM |
lwb.pdf |
PDF Document |
205.2 KB |
Oct 2 2012 12:27 AM |
M. P. Shiel - 2006-03-07 - Equality, Democracy, and their Killing Fields.htm |
HTML File |
17.2 KB |
Oct 2 2012 12:31 AM |
MacQueen.pdf |
PDF Document |
692.4 KB |
Oct 2 2012 12:31 AM |
MacWorld US - 2007 04.pdf |
PDF Document |
23.5 MB |
Oct 2 2012 12:33 AM |
Madame_Guillotine.pdf |
PDF Document |
114.8 KB |
Oct 2 2012 12:31 AM |
Madonna Listed Among America's 'Most Powerful Jews'.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:30 AM |
MagnaCarta.pdf |
PDF Document |
29.8 KB |
Oct 2 2012 12:27 AM |
main.css |
Stylesheet |
1022 Bytes |
Oct 2 2012 12:32 AM |
maine.pdf |
PDF Document |
571.1 KB |
Oct 2 2012 12:27 AM |
maine_rape.pdf |
PDF Document |
718.9 KB |
Oct 2 2012 12:32 AM |
Make Your Cheque out to God-Cash.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:29 AM |
Mali - Africans Still Practice Human Sacrifice.htm |
HTML File |
8.3 KB |
Oct 2 2012 12:34 AM |
MalleusAcrobat.pdf |
PDF Document |
2.4 MB |
Oct 2 2012 12:31 AM |
malleus_maleficarum.zip |
ZIP Archive |
795.3 KB |
Oct 2 2012 12:28 AM |
ManagementSummary-V2.2.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:33 AM |
manifeste.pdf |
PDF Document |
567.8 KB |
Oct 2 2012 12:30 AM |
Mar01.pdf |
PDF Document |
895.5 KB |
Oct 2 2012 12:31 AM |
Mar02.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:31 AM |
Mar03.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:31 AM |
Mar04.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:31 AM |
Mar06.pdf |
PDF Document |
807 KB |
Oct 2 2012 12:32 AM |
marchupcountry.pdf |
PDF Document |
891.6 KB |
Oct 2 2012 12:31 AM |
marchupcountry.rtf |
RTF File |
2.3 MB |
Oct 2 2012 12:29 AM |
Marcus Epstein and Michelle Malkin.htm |
HTML File |
24.7 KB |
Oct 2 2012 12:33 AM |
MaresNest.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:32 AM |
Marian Evans -- Catastrophe in Kansas City.htm |
HTML File |
81.4 KB |
Oct 2 2012 12:31 AM |
Mariel Deja Vu.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:33 AM |
Mark Weber - 2004-07-09 - ADL Strongman Panics at Break in 'Holocaust' Party Line.txt |
Text File |
18.8 KB |
Oct 2 2012 12:28 AM |
Mark Weber - 2006-02-10 - Holocaust Survivor Memoir Exposed as Fraud.htm |
HTML File |
7.6 KB |
Oct 2 2012 12:32 AM |
Mark Weber - 2006-03-16 - The Jewish Role in the Bolshevik Revolution and Russia's Early Soviet Regime.htm |
HTML File |
18.3 KB |
Oct 2 2012 12:32 AM |
Marshall - The Last Circle (unpublished manuscript on the Octopus mafia organization) (1994).pdf |
PDF Document |
471.7 KB |
Oct 2 2012 12:32 AM |
Marshals - Innocent People Placed On 'Watch List' To Meet Quota.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:33 AM |
Marxists Gamble on Geeks.htm |
HTML File |
11.6 KB |
Oct 2 2012 12:28 AM |
MaryPhaghanSong.htm |
HTML File |
9.5 KB |
Oct 2 2012 12:33 AM |
Mass Grave Containing Kosovo Serbs Found.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:28 AM |
Mass Grave of Massacred Poles Found in Ukraine.htm |
HTML File |
25.9 KB |
Oct 2 2012 12:29 AM |
Massive Debt Could Trigger Great Depression.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:32 AM |
Matthew Downing - 2006-03-24 - Massachusetts - Pro-White Outreach Frustrates Local Media, ADL.htm |
HTML File |
15.7 KB |
Oct 2 2012 12:33 AM |
Matthew Hale - Justice Denied.htm |
HTML File |
12.6 KB |
Oct 2 2012 12:31 AM |
May01.pdf |
PDF Document |
791.5 KB |
Oct 2 2012 12:30 AM |
May02.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:27 AM |
May03.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:29 AM |
May04.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:33 AM |
MBOE.pdf |
PDF Document |
5.7 MB |
Oct 2 2012 12:30 AM |
mcveigh.htm |
HTML File |
24 KB |
Oct 2 2012 12:30 AM |
mcveigh.pdf |
PDF Document |
136.3 KB |
Oct 2 2012 12:33 AM |
mediabypass.pdf |
PDF Document |
745.4 KB |
Oct 2 2012 12:29 AM |
Media Note - 'Michael Savage' Lashes Out Against Nick Berg and His Family.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:31 AM |
Medicating heretics.htm |
HTML File |
9.1 KB |
Oct 2 2012 12:33 AM |
meet_your_neighbors.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:32 AM |
MeinKampf.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:33 AM |
meinkampf.rtf |
RTF File |
3.5 MB |
Oct 2 2012 12:31 AM |
meinkampf.zip |
ZIP Archive |
702.5 KB |
Oct 2 2012 12:31 AM |
Melchizedek_Drunvalo_#BF2F1.pdf |
PDF Document |
3.9 MB |
Oct 2 2012 12:28 AM |
Mel Gibson's Anti-Zionist Priest Dies.htm |
HTML File |
8 KB |
Oct 2 2012 12:31 AM |
Mel Gibson Denounces Jews' War.htm |
HTML File |
24 KB |
Oct 2 2012 12:33 AM |
memberapp.html |
HTML File |
2.8 KB |
Oct 2 2012 12:28 AM |
Memo Proves Brown Paid for Chertoff's Incompetence.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:33 AM |
memories%20of%20freedom.pdf |
PDF Document |
4.5 MB |
Oct 2 2012 12:30 AM |
menu.htm |
HTML File |
18 KB |
Oct 2 2012 12:30 AM |
Merry Christmas -- and on to Victory!.htm |
HTML File |
10.7 KB |
Oct 2 2012 12:29 AM |
Merry Orthodox Christmas.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:28 AM |
Mestizo Gangs Control the Suburbs.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:30 AM |
Mestizos too violent for open debate, crowd control impossible.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:28 AM |
Mexico Conquers Texas.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:33 AM |
Mexico Ups the Ante in Conflict with American Blacks.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:33 AM |
Michael Chertoff - 'Trust Us'.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:31 AM |
Michael O'Meara - 2005-11-05 - Katrina's Intimation of the End - Afterthoughts on the Impending Catastrophe.txt |
Text File |
15.7 KB |
Oct 2 2012 12:32 AM |
Middle Class Families in Worse Shape Than Ever, Study Finds.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:31 AM |
Milch.pdf |
PDF Document |
2.3 MB |
Oct 2 2012 12:31 AM |
MillerPuckette Book 06-2007.pdf |
PDF Document |
1.9 MB |
Oct 2 2012 12:28 AM |
minimanual.htm |
HTML File |
28.5 KB |
Oct 2 2012 12:27 AM |
Minnesotans Love Non-Whites.htm |
HTML File |
2.2 KB |
Oct 2 2012 12:27 AM |
Minnesota Shocker - Black Muslim Wins Primary.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:29 AM |
minoritieslagdespitefcatgains.html |
HTML File |
5.8 KB |
Oct 2 2012 12:33 AM |
minoritytestscoregap.html |
HTML File |
6.6 KB |
Oct 2 2012 12:34 AM |
misc.html |
HTML File |
31.5 KB |
Oct 2 2012 12:33 AM |
Miscegenator Murders White 'Girlfriend' and Unborn Child.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:29 AM |
missing.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:32 AM |
Mission Fights Eastern European Sex Slave Traffic.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:33 AM |
Mistrial for Accused Jewish Mafia Godfather.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:33 AM |
mlk.pdf |
PDF Document |
608.1 KB |
Oct 2 2012 12:32 AM |
MLK101.pdf |
PDF Document |
276.7 KB |
Oct 2 2012 12:33 AM |
mlkday.pdf |
PDF Document |
464.4 KB |
Oct 2 2012 12:33 AM |
mlkflyer.pdf |
PDF Document |
91.6 KB |
Oct 2 2012 12:30 AM |
Mogadishu Redux -- The Irrepressible Genetics Of Simian Negroids.nws |
NWS File |
111.1 KB |
Oct 2 2012 12:33 AM |
Mom Gives Kids Dose O’ Diversity.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:31 AM |
MoneyChangers.pdf |
PDF Document |
172 KB |
Oct 2 2012 12:31 AM |
More 'Racist' AIDS Statistics.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:31 AM |
More Illegal Aliens Accused in Gang Rapes.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
More Jewish Mobsters Arriving.htm |
HTML File |
7.7 KB |
Oct 2 2012 12:30 AM |
morel.pdf |
PDF Document |
342.2 KB |
Oct 2 2012 12:32 AM |
More Legal Atrocities Against Serbian Whites.htm |
HTML File |
9.5 KB |
Oct 2 2012 12:31 AM |
Morell.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:31 AM |
More on Reparations |
Unknown |
18.8 KB |
Oct 2 2012 12:33 AM |
More on the Cabbala.htm |
HTML File |
7.9 KB |
Oct 2 2012 12:34 AM |
More on the Orlando Sentinel's Campaign Against Free Speech and Thought.htm |
HTML File |
7.4 KB |
Oct 2 2012 12:32 AM |
MorrisDeesDivorcePapers.pdf |
PDF Document |
33.4 KB |
Oct 2 2012 12:31 AM |
MorrisDeesFactSheet.pdf |
PDF Document |
203.1 KB |
Oct 2 2012 12:33 AM |
MossadKillingMahcine.rtf |
RTF File |
36.4 KB |
Oct 2 2012 12:28 AM |
Mothers in Houston Join Katrina Altercation.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:31 AM |
ms13_us.pdf |
PDF Document |
295.9 KB |
Oct 2 2012 12:29 AM |
MuadDib's Primer on the Jews.htm |
HTML File |
71.9 KB |
Oct 2 2012 12:32 AM |
Multicultural Jihad Wrecks Dutch Racial Harmony.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:27 AM |
Multiracial Children Have More Psychological Problems.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:30 AM |
Multiracialism and Conservatism.htm |
HTML File |
21.3 KB |
Oct 2 2012 12:33 AM |
mumiamurderer.pdf |
PDF Document |
277.5 KB |
Oct 2 2012 12:31 AM |
Museum Pulls 'Offensive' Artwork.htm |
HTML File |
7.3 KB |
Oct 2 2012 12:34 AM |
music.html |
HTML File |
61.1 KB |
Oct 2 2012 12:33 AM |
Muslim 'Tolerance' Boils Over in Egypt.htm |
HTML File |
5.4 KB |
Oct 2 2012 12:31 AM |
Muslims Back Down In Face of White 'Threat'.htm |
HTML File |
6.5 KB |
Oct 2 2012 12:32 AM |
My Big Biofuels Bet.htm |
HTML File |
32.5 KB |
Oct 2 2012 12:34 AM |
MY FAREWELL TO ISRAEL.htm |
HTML File |
266.4 KB |
Oct 2 2012 12:31 AM |
MyHonorIsLoyalty.pdf |
PDF Document |
996.8 KB |
Oct 2 2012 12:31 AM |
MyLifeOnThePlains.pdf |
PDF Document |
732 KB |
Oct 2 2012 12:34 AM |
Mystery of the mummies.htm |
HTML File |
19.1 KB |
Oct 2 2012 12:30 AM |
MythOfDiversity.pdf |
PDF Document |
31 KB |
Oct 2 2012 12:31 AM |
Myths, Misunderstandings, and Outright Lies - gold-confiscation-1933.htm |
HTML File |
35.1 KB |
Oct 2 2012 12:31 AM |
N.O. Cops Suspected of Stealing Up to 200 Cars.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:27 AM |
Namibia, Africa - One Rape Every 60 Minutes.htm |
HTML File |
1.9 KB |
Oct 2 2012 12:30 AM |
Namibia - Tribe Demands German Reparations.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:33 AM |
nascar.pdf |
PDF Document |
60.5 KB |
Oct 2 2012 12:28 AM |
Natallnews site.doc |
Microsoft Word Document |
67 KB |
Oct 2 2012 12:31 AM |
National Alliance Comic - Saga Of White Will.pdf |
PDF Document |
17.2 MB |
Oct 2 2012 12:32 AM |
National Alliance Speaks at Campus Mideast Forum.htm |
HTML File |
10.2 KB |
Oct 2 2012 12:30 AM |
National Vanguard - Just Say No to Illegal Immigrants.htm |
HTML File |
9.2 KB |
Oct 2 2012 12:32 AM |
National Vanguard Activist Wins Victory Against Censorship.htm |
HTML File |
6.3 KB |
Oct 2 2012 12:31 AM |
National Vanguard Magazine #129 - sample.pdf |
PDF Document |
336.3 KB |
Oct 2 2012 12:33 AM |
nationontrial.pdf |
PDF Document |
540.4 KB |
Oct 2 2012 12:31 AM |
nationontrial.rtf |
RTF File |
290.6 KB |
Oct 2 2012 12:32 AM |
NaturesEternalReligionOrig.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:28 AM |
nazism - White Pride.htm |
HTML File |
19.3 KB |
Oct 2 2012 12:31 AM |
nc.photos.html |
HTML File |
5.1 KB |
Oct 2 2012 12:31 AM |
Nebilung.pdf |
PDF Document |
491.8 KB |
Oct 2 2012 12:33 AM |
Nebilung.rtf |
RTF File |
598.8 KB |
Oct 2 2012 12:31 AM |
Negro Accused of Spreading AIDS.htm |
HTML File |
4 KB |
Oct 2 2012 12:32 AM |
neonazi-chart.pdf |
PDF Document |
69.6 KB |
Oct 2 2012 12:30 AM |
ner.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:31 AM |
Nerds Join Neo-Cons to Oppose National Vanguard.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:28 AM |
Netherlands - Jihadi Plot Upsets Liberals.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:33 AM |
Netherlands Braces for 'Jihad'.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:32 AM |
nettinin04112006.html |
HTML File |
113.3 KB |
Oct 2 2012 12:30 AM |
New Africa.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:33 AM |
NewAfricans.pdf |
PDF Document |
35 KB |
Oct 2 2012 12:33 AM |
New Book Helps White Families Become Prosperous.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:30 AM |
New Charges for Lightfingers Tom.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:28 AM |
New From FEMA - The Looter Relocation Program.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:31 AM |
New Jersey - Jews Refuse to Vote in Churches.htm |
HTML File |
7.5 KB |
Oct 2 2012 12:31 AM |
New Jersey Girl Murdered and Dismembered By Mestizos.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:27 AM |
New Jersey Icebergs and Whores.htm |
HTML File |
24.8 KB |
Oct 2 2012 12:32 AM |
New Jersey Rabbi Says Katrina Refugees Welcome in Utah.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:32 AM |
New Orleans - Cops Join in Looting.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:29 AM |
New Orleans - Second Amendment Suspended.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:32 AM |
New Orleans - The Rise of 'Mighty Whitey'.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
New Orleans Africa-Like Well Before Hurricane Katrina.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:33 AM |
New Orleans and 'The Gods of the Copybook Headings'.htm |
HTML File |
27.3 KB |
Oct 2 2012 12:33 AM |
New Orleans Chaos Reveals America on the Brink.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:31 AM |
New Orleans Corrupt 'Down to the Bone,' Former Pol Charges.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
New Orleans Descends into Africa-like Savagery.htm |
HTML File |
12.4 KB |
Oct 2 2012 12:33 AM |
New Orleans gun confiscation is foolish and illegal.htm |
HTML File |
7.2 KB |
Oct 2 2012 12:32 AM |
New Orleans Parody Challenges System Media.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:34 AM |
New Orleans Pays For Affirmative Action.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:32 AM |
New Report Sheds Light on Hispanics in U.S..htm |
HTML File |
3.8 KB |
Oct 2 2012 12:29 AM |
New Sex Scandal Rocks Holy See.htm |
HTML File |
5.2 KB |
Oct 2 2012 12:28 AM |
Newsletter Sign Up.rar |
RAR Archive |
601.2 KB |
Oct 2 2012 12:33 AM |
newsletter_092005.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:28 AM |
Newspaper Calls Mass-Murder 'Sad' Flier Distribution 'Despicable'.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:33 AM |
Newsweek - Superlobbyist is Crooked.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:31 AM |
New V-TV Video - Katrina Relief.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:33 AM |
newyorkandhillaryschineserockets.html |
HTML File |
4.9 KB |
Oct 2 2012 12:31 AM |
New Yorkers to study about Israel.htm |
HTML File |
14.9 KB |
Oct 2 2012 12:28 AM |
New York Times - Chertoff Approved Abu Ghraib Interrogation Methods.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:33 AM |
NFS_I.rar |
RAR Archive |
89.9 MB |
Oct 2 2012 12:32 AM |
Nick Griffin - The Race Murders the Media Ignore.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:32 AM |
ninety_five_theses_on_the_holoca - Ninety Five Theses on the Holocaust.htm |
HTML File |
35 KB |
Oct 2 2012 12:31 AM |
NJ - Mestizo Cop Helped Drug Ring Say Officials.htm |
HTML File |
4 KB |
Oct 2 2012 12:30 AM |
NJ - New Black Panthers Come to Town.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:27 AM |
NJ Ethics Office - Fagan Stole $400,000.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:33 AM |
NJ Governor's Jewish Financial Angel - Also Clinton Backer, 'Holocaust' Appointee.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:28 AM |
No, We're Not 'All Israelis Now'.htm |
HTML File |
8.6 KB |
Oct 2 2012 12:28 AM |
No Black Day in Jesse's Hometown.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:34 AM |
No Debit Cards for White People.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:33 AM |
noose.htm |
HTML File |
11 KB |
Oct 2 2012 12:28 AM |
Norman Language Flourishes in the Channel Islands.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:33 AM |
North American Students Trained for 'Merger'.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:30 AM |
Norway - 19,000 'Asylum' Seekers Evade Authorities.htm |
HTML File |
2 KB |
Oct 2 2012 12:31 AM |
Norwegian Patriots Demolish Sell-outs.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:31 AM |
Norwegians Discover Joys of Islam.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:30 AM |
Norwegian Teens Cool to 'Diversity'.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:30 AM |
notes on Phenomenology.doc |
Microsoft Word Document |
580 KB |
Oct 2 2012 12:31 AM |
notguilty.pdf |
PDF Document |
211.2 KB |
Oct 2 2012 12:33 AM |
notguilty.rtf |
RTF File |
142 KB |
Oct 2 2012 12:28 AM |
Nov01.pdf |
PDF Document |
909 KB |
Oct 2 2012 12:31 AM |
Nov02.pdf |
PDF Document |
1.8 MB |
Oct 2 2012 12:31 AM |
Nov03.pdf |
PDF Document |
871 KB |
Oct 2 2012 12:33 AM |
Nov04.pdf |
PDF Document |
634.2 KB |
Oct 2 2012 12:32 AM |
nowarforisrael.pdf |
PDF Document |
8.2 KB |
Oct 2 2012 12:32 AM |
no_place_1.pdf |
PDF Document |
802.2 KB |
Oct 2 2012 12:29 AM |
nuremberg.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:30 AM |
Nutty Professor Charged In Hate Crime Hoax.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:30 AM |
nv_terrorfree.pdf |
PDF Document |
571.3 KB |
Oct 2 2012 12:31 AM |
nv_ussliberty.pdf |
PDF Document |
156.3 KB |
Oct 2 2012 12:28 AM |
nv_warforisrael.pdf |
PDF Document |
113.9 KB |
Oct 2 2012 12:31 AM |
NY Times Hit Hard as Controlled Media Take Continued Beating.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:31 AM |
Oakland - Black-Yemeni Tension Ratcheted Up.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:28 AM |
Oakland - Black Muslim Tensions Heightened.htm |
HTML File |
7.5 KB |
Oct 2 2012 12:30 AM |
Oakland - Blacks Loot Burned-Out Shell of Arab Store.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:27 AM |
Oakland - Video Beating Victim Comes Forward.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:33 AM |
Oakland Beating Video - Cops Baffled.htm |
HTML File |
4 KB |
Oct 2 2012 12:30 AM |
Oakland Update - Blacks Charged With Hate Crimes.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:28 AM |
ocbpt.pdf |
PDF Document |
3.3 MB |
Oct 2 2012 12:31 AM |
ocbpt.rtf |
RTF File |
5.8 MB |
Oct 2 2012 12:31 AM |
ocbpt.zip |
ZIP Archive |
3.5 MB |
Oct 2 2012 12:33 AM |
Oct01.pdf |
PDF Document |
905.4 KB |
Oct 2 2012 12:31 AM |
Oct02.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:28 AM |
Oct03.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:28 AM |
Oct04.pdf |
PDF Document |
705.3 KB |
Oct 2 2012 12:33 AM |
October 7, 1571 - The Deliverance of Europe at Lepanto.htm |
HTML File |
11 KB |
Oct 2 2012 12:30 AM |
Of Course There Is an Israel Lobby.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:33 AM |
Ohio - War Protest Turns Violent.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:27 AM |
ohio college crime - 5349405.pdf |
PDF Document |
30.3 KB |
Oct 2 2012 12:28 AM |
ohn Lennon's 'Imagine' (revised).htm |
HTML File |
7.5 KB |
Oct 2 2012 12:32 AM |
Once We See Black We NEVER Go Back.htm |
HTML File |
6 KB |
Oct 2 2012 12:31 AM |
One Percent of Population Commits Half of Homicides.htm |
HTML File |
120.4 KB |
Oct 2 2012 12:31 AM |
OneSheaf.pdf |
PDF Document |
549.2 KB |
Oct 2 2012 12:30 AM |
On White Genocide.htm |
HTML File |
11.8 KB |
Oct 2 2012 12:32 AM |
opphack.htm |
HTML File |
1.7 KB |
Oct 2 2012 12:31 AM |
oppressed.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:31 AM |
Optimized Krystal Planet Fall 2005 Catalog v3.pdf |
PDF Document |
3.4 MB |
Oct 2 2012 12:33 AM |
OriginsOfChristianity.pdf |
PDF Document |
537.6 KB |
Oct 2 2012 12:31 AM |
Over 75,000 AIDS Cases in New York City.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:33 AM |
Pale Horsemen.pdf |
PDF Document |
102.2 KB |
Oct 2 2012 12:27 AM |
paleoamericanethnicdiversity.doc |
Microsoft Word Document |
256 KB |
Oct 2 2012 12:33 AM |
panels.pdf |
PDF Document |
259.9 KB |
Oct 2 2012 12:31 AM |
PassingOfGreatRace.pdf |
PDF Document |
315.5 KB |
Oct 2 2012 12:33 AM |
PassingOfTheGreatRace.rtf |
RTF File |
438.5 KB |
Oct 2 2012 12:31 AM |
Patric Ewing testifies he twice had oral sex at Gold Club.htm |
HTML File |
28.7 KB |
Oct 2 2012 12:33 AM |
Paul Jalsevac - The Inherent Racism Of Population Control.pdf |
PDF Document |
380.7 KB |
Oct 2 2012 12:28 AM |
Pay No Attention to the Jews Behind the Curtain—the Iron Curtain.htm |
HTML File |
29.8 KB |
Oct 2 2012 12:28 AM |
PC Desecration of Spanish Holy Site.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:33 AM |
pearlharbor.pdf |
PDF Document |
559 KB |
Oct 2 2012 12:27 AM |
peltreport.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:33 AM |
peltreport.rtf |
RTF File |
2 MB |
Oct 2 2012 12:31 AM |
Pennies.rtf |
RTF File |
3.7 KB |
Oct 2 2012 12:34 AM |
People Of Africa.pdf |
PDF Document |
134.1 KB |
Oct 2 2012 12:33 AM |
People Of Africa.zip |
ZIP Archive |
29.1 KB |
Oct 2 2012 12:33 AM |
Peterloo Massacre.htm |
HTML File |
33.4 KB |
Oct 2 2012 12:32 AM |
Petty Criminal Leaves Sarkozy Red-Faced.htm |
HTML File |
3 KB |
Oct 2 2012 12:33 AM |
Piezoelectric Windmill.pdf |
PDF Document |
145.2 KB |
Oct 2 2012 12:29 AM |
pipe.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:33 AM |
pipermel.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:30 AM |
Playstation Copying 4 Mac.pdf |
PDF Document |
33.5 KB |
Oct 2 2012 12:28 AM |
pledge.pdf |
PDF Document |
722.5 KB |
Oct 2 2012 12:29 AM |
Poignant Photo Strikes Reader.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:29 AM |
PoisonousMushroom.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:30 AM |
Poland Abruptly Cancels a Speech By Critic of the Jewish State.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:28 AM |
Police - Hurricane Evacuees Kill Woman who Helped Them.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:31 AM |
Police Demand Resignation of Black Commissioner.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:28 AM |
Police Looting - Racial Realities Exposed in New Orleans.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:28 AM |
Police Ordered to Stop Looters.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:31 AM |
Polish-Americans Celebrate Harvest Festival.htm |
HTML File |
3 KB |
Oct 2 2012 12:31 AM |
Polish Father of US Cavalry Laid to Rest.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:30 AM |
Political Correctness - The Scourge of Our Times.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:28 AM |
Political Prisoners - In America.htm |
HTML File |
8.3 KB |
Oct 2 2012 12:31 AM |
Poll Shows Rising Tide of anti-Semitism on Eve of Holocaust Day.htm |
HTML File |
3 KB |
Oct 2 2012 12:31 AM |
Polls Show Opposition to Iraq War at All-Time High.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:30 AM |
poster1470.jpg |
JPEG Image |
113.1 KB |
Oct 2 2012 12:32 AM |
Powerful Gains For Pro-Whites in Norwegian Elections.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:31 AM |
Pre-Traumatic Stress Disorder-A Glimpse Into Israeli Collective Psychosis.htm |
HTML File |
31.1 KB |
Oct 2 2012 12:34 AM |
President Putin - 'Orthodox Christianity an Integral Part of Russian Culture'.htm |
HTML File |
2 KB |
Oct 2 2012 12:28 AM |
Pressure on Chertoff Builds.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:33 AM |
Principal Negative Stereotypes Against European Americans.htm |
HTML File |
7.4 KB |
Oct 2 2012 12:32 AM |
printer.php.htm |
HTML File |
5.2 KB |
Oct 2 2012 12:30 AM |
prison_camps.pdf |
PDF Document |
774.5 KB |
Oct 2 2012 12:31 AM |
Pro-Zionist Televangelist Advocates Murder.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:32 AM |
Pro and Con - NFL Star Allegedly Runs Over Teens in Stolen Car.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:28 AM |
Progress Party Gets It Right.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:32 AM |
Prophecy of the Seeress.htm |
HTML File |
42 KB |
Oct 2 2012 12:31 AM |
Protestants and Catholics Unite -- For a Brown Ireland.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:32 AM |
Protests Loom in Far West, Washington.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:31 AM |
ProtocolsOfZion.pdf |
PDF Document |
215.8 KB |
Oct 2 2012 12:31 AM |
PRreal.pdf |
PDF Document |
446.3 KB |
Oct 2 2012 12:31 AM |
Prussian Blue and the First Amendment.htm |
HTML File |
8.1 KB |
Oct 2 2012 12:29 AM |
PrussianismAndSocialism.pdf |
PDF Document |
191.3 KB |
Oct 2 2012 12:34 AM |
PUB637.pdf |
PDF Document |
232.8 KB |
Oct 2 2012 12:29 AM |
puddingrecipe .pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:32 AM |
Purchasing Precious Metals.htm |
HTML File |
105.7 KB |
Oct 2 2012 12:29 AM |
Putin's Cannibals 'Gaffe'.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:32 AM |
Putin, the Patriot.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:29 AM |
Putin - Those Who Bombed Serbia Should Pay Damages.htm |
HTML File |
3 KB |
Oct 2 2012 12:33 AM |
Putin Pilgrimage Strengthens Greco-Russian Links.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:28 AM |
putting_israel_first.pdf |
PDF Document |
1.1 MB |
Oct 2 2012 12:28 AM |
QueenIsabella.pdf |
PDF Document |
875.1 KB |
Oct 2 2012 12:31 AM |
QueenIsabella.rtf |
RTF File |
350.7 KB |
Oct 2 2012 12:34 AM |
Questions of Preferential Treatment Raised in Sex Case.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:33 AM |
Questions That May Not Be Asked About New Orleans.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:34 AM |
QuotesAboutJews.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:33 AM |
Rabbi calls for extermination of all Palestinian males.htm |
HTML File |
5 KB |
Oct 2 2012 12:32 AM |
Rabbis to Israeli Military - Kill More Non-Jews.htm |
HTML File |
6.9 KB |
Oct 2 2012 12:33 AM |
Race-based Medicine Confirms Genetic Differences.htm |
HTML File |
2.5 KB |
Oct 2 2012 12:30 AM |
race-mixing1.pdf |
PDF Document |
856.4 KB |
Oct 2 2012 12:28 AM |
Race and Murder.htm |
HTML File |
5.3 KB |
Oct 2 2012 12:34 AM |
Race Baiting as New Orleans Sinks.htm |
HTML File |
6.4 KB |
Oct 2 2012 12:32 AM |
racebook.doc |
Microsoft Word Document |
683 KB |
Oct 2 2012 12:34 AM |
RaceBook2.doc |
Microsoft Word Document |
817.5 KB |
Oct 2 2012 12:31 AM |
RaceEvolutionBehavior.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:31 AM |
Race Hated - What Drives Jews.htm |
HTML File |
8.8 KB |
Oct 2 2012 12:31 AM |
Race in Ancient Egypt.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:33 AM |
RaceMythsFromLeft.pdf |
PDF Document |
39.7 KB |
Oct 2 2012 12:29 AM |
RaceOfAncientEgypt.pdf |
PDF Document |
258.8 KB |
Oct 2 2012 12:31 AM |
Race_Evolution_Behavior.pdf |
PDF Document |
2.7 MB |
Oct 2 2012 12:31 AM |
race_traitor.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:28 AM |
RachelCorrie.pdf |
PDF Document |
129.4 KB |
Oct 2 2012 12:31 AM |
Racial Battle-Lines Divide School.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:28 AM |
Racial Explosion 60 Years On.htm |
HTML File |
24.3 KB |
Oct 2 2012 12:29 AM |
racialgapinschoolssplitsatownproudofdiversity.html |
HTML File |
16.3 KB |
Oct 2 2012 12:32 AM |
racialgapremainswideonmcasscores.html |
HTML File |
9.1 KB |
Oct 2 2012 12:33 AM |
Racialism versus Communitarianism.htm |
HTML File |
25.8 KB |
Oct 2 2012 12:32 AM |
Racial Media Jump on Katrina News.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:28 AM |
RacialOriginOfJews.pdf |
PDF Document |
51.7 KB |
Oct 2 2012 12:28 AM |
Racial Reality and the New Orleans Nightmare.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
Racial Test Gap Remains Large in California.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:33 AM |
Rad-ad.pdf |
PDF Document |
123.4 KB |
Oct 2 2012 12:27 AM |
Radical White Intellectual Predicts World-Altering Tempest.htm |
HTML File |
9.8 KB |
Oct 2 2012 12:29 AM |
Radio Station Urges 'Kill Tookie' Emails to Schwarzenegger.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
raffle2005.pdf |
PDF Document |
451.1 KB |
Oct 2 2012 12:31 AM |
rahowa.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:29 AM |
Ramadan Madness Looms.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:28 AM |
Rap King Shot in Florida.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:31 AM |
Ravage_1.pdf |
PDF Document |
445.8 KB |
Oct 2 2012 12:31 AM |
Ravage_2.pdf |
PDF Document |
654.7 KB |
Oct 2 2012 12:28 AM |
READ-DavidLane's final addr.PDF |
PDF Document |
21.5 KB |
Oct 2 2012 12:34 AM |
Reading, Writing and Race.htm |
HTML File |
230.1 KB |
Oct 2 2012 12:28 AM |
README Open Letter- English.PDF |
PDF Document |
20.8 KB |
Oct 2 2012 12:32 AM |
Real Racial Supremacism.htm |
HTML File |
24.3 KB |
Oct 2 2012 12:28 AM |
Recent Events Show America is Changing.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:32 AM |
Reflections Dental.rtf |
RTF File |
3.1 KB |
Oct 2 2012 12:31 AM |
Refugee Numbers On the Rise.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:33 AM |
Religious Group Flagellate Selves Over 'Reparations'.htm |
HTML File |
7.2 KB |
Oct 2 2012 12:28 AM |
Remember the Turkish Genocide of the Pontic Greeks.htm |
HTML File |
6.2 KB |
Oct 2 2012 12:33 AM |
renaissance.html |
HTML File |
41.5 KB |
Oct 2 2012 12:27 AM |
Renewable Energy Home Products Brochure.pdf |
PDF Document |
935.5 KB |
Oct 2 2012 12:28 AM |
Report - Cannibalism in New Orleans.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:32 AM |
reportblackslikelytobespecialedstudents.html |
HTML File |
1.6 KB |
Oct 2 2012 12:27 AM |
Report Illegal Aliens - status_report.htm |
HTML File |
39.5 KB |
Oct 2 2012 12:32 AM |
Republicans Back Pro-Homosexual 'Hate Crimes' Expansion.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:30 AM |
resistancetoday.htm |
HTML File |
80.2 KB |
Oct 2 2012 12:34 AM |
Resisting Defamation - Principal Negative Stereotypes Against European Americans.htm |
HTML File |
1.7 KB |
Oct 2 2012 12:31 AM |
Resisting Defamatory Anti-White Language.htm |
HTML File |
15.9 KB |
Oct 2 2012 12:31 AM |
Restaurant Owner_ NOT GUILTY for squishing savage Shantavious!.nws |
NWS File |
2.1 KB |
Oct 2 2012 12:33 AM |
Restoring The Small Farm.htm |
HTML File |
55.5 KB |
Oct 2 2012 12:27 AM |
RESULTS OF MINNESOTA TRANSRACIAL ADOPTION STUDY.htm |
HTML File |
9.9 KB |
Oct 2 2012 12:32 AM |
RethinkingImmigration.pdf |
PDF Document |
305.8 KB |
Oct 2 2012 12:34 AM |
RevisionismConsequences.pdf |
PDF Document |
200.9 KB |
Oct 2 2012 12:31 AM |
revisionistpamphlets.pdf |
PDF Document |
481.4 KB |
Oct 2 2012 12:31 AM |
revisionistpamphlets.rtf |
RTF File |
354.8 KB |
Oct 2 2012 12:30 AM |
RevoltAgainstCivilization.pdf |
PDF Document |
488.6 KB |
Oct 2 2012 12:33 AM |
RFP_SFP-App.pdf |
PDF Document |
679.1 KB |
Oct 2 2012 12:31 AM |
Rhode Island - Cops Catch Illegals at Dem Chair's House.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:33 AM |
RightAndWrongRacism.pdf |
PDF Document |
43 KB |
Oct 2 2012 12:28 AM |
rights.pdf |
PDF Document |
47.5 KB |
Oct 2 2012 12:27 AM |
RisingTideOfColor.pdf |
PDF Document |
545.1 KB |
Oct 2 2012 12:29 AM |
RitualMurderInvestigation.pdf |
PDF Document |
4.3 MB |
Oct 2 2012 12:30 AM |
RitualMurderMythOrReality.pdf |
PDF Document |
245.9 KB |
Oct 2 2012 12:32 AM |
Robert S. Griffin - 2004-09-05 - William Pierce - A Reminiscence.htm |
HTML File |
34.4 KB |
Oct 2 2012 12:34 AM |
RoboticsUIUC_CropProtectionConf.pdf |
PDF Document |
494 KB |
Oct 2 2012 12:33 AM |
Rockers Demand Recognition of Armenian Genocide.htm |
HTML File |
7.2 KB |
Oct 2 2012 12:30 AM |
Rommel.pdf |
PDF Document |
4.8 MB |
Oct 2 2012 12:32 AM |
Rosa Brooks - Criticize Israel - You're an Anti-Semite.htm |
HTML File |
45.1 KB |
Oct 2 2012 12:28 AM |
RosenbergMemoirs.pdf |
PDF Document |
705.2 KB |
Oct 2 2012 12:33 AM |
rtc_1-01.html |
HTML File |
21.5 KB |
Oct 2 2012 12:30 AM |
rtc_1-02.html |
HTML File |
57.9 KB |
Oct 2 2012 12:33 AM |
rtc_1-03.html |
HTML File |
51 KB |
Oct 2 2012 12:33 AM |
rtc_1-04.html |
HTML File |
26.1 KB |
Oct 2 2012 12:31 AM |
rtc_1-05.html |
HTML File |
61 KB |
Oct 2 2012 12:28 AM |
rtc_2-06.html |
HTML File |
13 KB |
Oct 2 2012 12:28 AM |
rtc_2-07.html |
HTML File |
29.4 KB |
Oct 2 2012 12:30 AM |
rtc_2-08.html |
HTML File |
37.4 KB |
Oct 2 2012 12:30 AM |
rtc_2-09.html |
HTML File |
37.5 KB |
Oct 2 2012 12:28 AM |
rtc_3-10.html |
HTML File |
17.2 KB |
Oct 2 2012 12:28 AM |
rtc_3-11.html |
HTML File |
96.7 KB |
Oct 2 2012 12:32 AM |
rtc_3-12.html |
HTML File |
17.8 KB |
Oct 2 2012 12:33 AM |
rtc_intro.html |
HTML File |
22.2 KB |
Oct 2 2012 12:28 AM |
rtc_preface.html |
HTML File |
4.5 KB |
Oct 2 2012 12:32 AM |
RulesForLivingWithPeople.pdf |
PDF Document |
16.7 KB |
Oct 2 2012 12:29 AM |
Rural Traditions of the Pennsylvania Dutch Still Strong.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:32 AM |
Rush-un.pdf |
PDF Document |
82 KB |
Oct 2 2012 12:32 AM |
Russia - Jewish Group Worried About Russian Patriots.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:33 AM |
Russia - Sophisticated Sex Slave Operation Uncovered.htm |
HTML File |
6.1 KB |
Oct 2 2012 12:33 AM |
Russian State Duma Denounces Armenian Genocide.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:28 AM |
Russian Wealth in Hands of Jews - One Hundred Own Quarter of Wealth as Russians Starve.htm |
HTML File |
6.8 KB |
Oct 2 2012 12:31 AM |
Russia Ponders Tax on Childlessness.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:32 AM |
rvtr.pdf |
PDF Document |
929.6 KB |
Oct 2 2012 12:33 AM |
rwp_06_011_walt.pdf |
PDF Document |
1.2 MB |
Oct 2 2012 12:29 AM |
sacred_cavern.zip |
ZIP Archive |
422.5 KB |
Oct 2 2012 12:31 AM |
SaddestStory.pdf |
PDF Document |
7.2 KB |
Oct 2 2012 12:30 AM |
sales.html |
HTML File |
30.1 KB |
Oct 2 2012 12:31 AM |
San Diego Whites Protest Ethnic Cleansing.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:33 AM |
Sarah_Knox_Taylor_davis.pdf |
PDF Document |
24.1 KB |
Oct 2 2012 12:31 AM |
SATGapBW.pdf |
PDF Document |
314.9 KB |
Oct 2 2012 12:31 AM |
Savages.pdf |
PDF Document |
987.5 KB |
Oct 2 2012 12:34 AM |
savitri-pdf.zip |
ZIP Archive |
1.3 MB |
Oct 2 2012 12:33 AM |
saynotoextinction.pdf |
PDF Document |
25.9 KB |
Oct 2 2012 12:29 AM |
scamway.pdf |
PDF Document |
1.7 MB |
Oct 2 2012 12:29 AM |
School Officials Look the Other Way When Whites are Abused.htm |
HTML File |
7.5 KB |
Oct 2 2012 12:29 AM |
schoolsfacecivilrightsprobe.html |
HTML File |
5.9 KB |
Oct 2 2012 12:28 AM |
Science Strikes Back.htm |
HTML File |
86.9 KB |
Oct 2 2012 12:31 AM |
Scotland - Poseurs Headed for Kneecapping.htm |
HTML File |
6 KB |
Oct 2 2012 12:32 AM |
Scotland - Race Killing Case Opens.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:33 AM |
Seattle Test Scores Anguish.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:28 AM |
secondchance.pdf |
PDF Document |
130.4 KB |
Oct 2 2012 12:30 AM |
Secret Service agents say Cheney was drunk when he shot lawyer.htm |
HTML File |
7.4 KB |
Oct 2 2012 12:33 AM |
SecretsOfFedReserve.pdf |
PDF Document |
461.2 KB |
Oct 2 2012 12:28 AM |
security_911_2005color.pdf |
PDF Document |
216 KB |
Oct 2 2012 12:30 AM |
send_the_goyim.pdf |
PDF Document |
843.6 KB |
Oct 2 2012 12:29 AM |
Sep01.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:28 AM |
Sep02.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:33 AM |
Sep03.pdf |
PDF Document |
675.9 KB |
Oct 2 2012 12:34 AM |
Sep04.pdf |
PDF Document |
558.9 KB |
Oct 2 2012 12:34 AM |
Sex Offenders Slip Radar.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:28 AM |
Sex Rabbi - 'I'll Debate David Duke'.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:28 AM |
Sex Trade Flourishing in 'Holy Land'.htm |
HTML File |
2 KB |
Oct 2 2012 12:31 AM |
shadow.pdf |
PDF Document |
632.6 KB |
Oct 2 2012 12:30 AM |
shakedown2.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:30 AM |
shamiressays.pdf |
PDF Document |
875.8 KB |
Oct 2 2012 12:29 AM |
shamiressays.rtf |
RTF File |
1018.3 KB |
Oct 2 2012 12:33 AM |
Sharon - The Al Sharpton of the Middle East.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:31 AM |
ShatteringMythOfRacism.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:28 AM |
Shaun Walker - What Happened to Normal Behavior - 10-08-2005.pdf |
PDF Document |
247.3 KB |
Oct 2 2012 12:33 AM |
shelby - Terrorism In South Africa.htm |
HTML File |
17.3 KB |
Oct 2 2012 12:28 AM |
shirts.html |
HTML File |
17.6 KB |
Oct 2 2012 12:32 AM |
Shmuley loses it.htm |
HTML File |
34.2 KB |
Oct 2 2012 12:30 AM |
shongum_001-020.doc |
Microsoft Word Document |
788 KB |
Oct 2 2012 12:32 AM |
shongum_021-050.doc |
Microsoft Word Document |
343 KB |
Oct 2 2012 12:27 AM |
shongum_051-070.doc |
Microsoft Word Document |
493.5 KB |
Oct 2 2012 12:28 AM |
shongum_071-096.doc |
Microsoft Word Document |
323 KB |
Oct 2 2012 12:31 AM |
shongum_097-122.doc |
Microsoft Word Document |
228.5 KB |
Oct 2 2012 12:33 AM |
shongum_123-150.doc |
Microsoft Word Document |
786 KB |
Oct 2 2012 12:28 AM |
shongum_151-168.doc |
Microsoft Word Document |
552 KB |
Oct 2 2012 12:27 AM |
shongum_BIBLIOG_REFS.doc |
Microsoft Word Document |
20.5 KB |
Oct 2 2012 12:30 AM |
shongum_preface.doc |
Microsoft Word Document |
332.5 KB |
Oct 2 2012 12:31 AM |
shongum_preface.xhtml |
HTML File |
26.2 KB |
Oct 2 2012 12:28 AM |
shufeldt.pdf |
PDF Document |
4.9 MB |
Oct 2 2012 12:29 AM |
sikorski.pdf |
PDF Document |
937.3 KB |
Oct 2 2012 12:31 AM |
SilentJew.pdf |
PDF Document |
35.1 KB |
Oct 2 2012 12:28 AM |
Silver - Why You Should Own It.htm |
HTML File |
5.9 KB |
Oct 2 2012 12:31 AM |
SimpleArithmetic.pdf |
PDF Document |
14.6 KB |
Oct 2 2012 12:33 AM |
Singapore Bloggers Latest Victims of Multicultural Intolerance.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:31 AM |
Sinn Fein Touts for Third World Ireland at Westminster.htm |
HTML File |
6.2 KB |
Oct 2 2012 12:31 AM |
Sir Gawain and the Green Knight - Indo-European Archetypal Myth.htm |
HTML File |
20.1 KB |
Oct 2 2012 12:27 AM |
sl.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:34 AM |
Slave Account - Fiction.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:30 AM |
SlaveryWhatReallyHappened.pdf |
PDF Document |
22.1 KB |
Oct 2 2012 12:31 AM |
SmartFractionTheory.pdf |
PDF Document |
77.7 KB |
Oct 2 2012 12:31 AM |
smash.pdf |
PDF Document |
55.5 KB |
Oct 2 2012 12:31 AM |
smell_the_blood.pdf |
PDF Document |
846.5 KB |
Oct 2 2012 12:33 AM |
SocialDarwinism.pdf |
PDF Document |
15.7 KB |
Oct 2 2012 12:27 AM |
SocratesVsJesus.pdf |
PDF Document |
104.5 KB |
Oct 2 2012 12:34 AM |
So Long Tookie.htm |
HTML File |
6 KB |
Oct 2 2012 12:34 AM |
solzhenitsyn photo.jpg |
JPEG Image |
14.4 KB |
Oct 2 2012 12:30 AM |
Some Comments on 'Racism'.htm |
HTML File |
6.3 KB |
Oct 2 2012 12:33 AM |
Some Jews Still Attacking Mel Gibson.htm |
HTML File |
5 KB |
Oct 2 2012 12:28 AM |
Soros 'An Extremely Evil Person'.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:27 AM |
So You Think You're a White Anti-Racist.htm |
HTML File |
6.1 KB |
Oct 2 2012 12:29 AM |
So You Thought the Mob Was Run by Italians.htm |
HTML File |
18.1 KB |
Oct 2 2012 12:28 AM |
SP27.pdf |
PDF Document |
159 Bytes |
Oct 2 2012 12:34 AM |
specialtreatment.pdf |
PDF Document |
6.8 MB |
Oct 2 2012 12:27 AM |
Specific Sites Excluded from Google.fr and or Google.de.htm |
HTML File |
58.3 KB |
Oct 2 2012 12:31 AM |
Spelling Used TV to Push Homosexual Agenda.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:28 AM |
spiderjew.jpg |
JPEG Image |
6.9 KB |
Oct 2 2012 12:34 AM |
Spoof - Byzantine Emperor Apologizes to Muslims For Quote.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:31 AM |
srebrenica.pdf |
PDF Document |
15.1 MB |
Oct 2 2012 12:30 AM |
ssracetheory.pdf |
PDF Document |
2.7 MB |
Oct 2 2012 12:29 AM |
St. George and the Harridan.htm |
HTML File |
5.2 KB |
Oct 2 2012 12:33 AM |
St. Petersburg, FL - ethnic.htm |
HTML File |
22.9 KB |
Oct 2 2012 12:34 AM |
Stab in the Back - Israel’s Attack on the USS Liberty.htm |
HTML File |
10.3 KB |
Oct 2 2012 12:31 AM |
Stalin’s Willing Executioners - 2005-11-05.txt |
Text File |
22.8 KB |
Oct 2 2012 12:32 AM |
Stalin’s Willing Executioners.txt |
Text File |
37 KB |
Oct 2 2012 12:31 AM |
Stanford - Racial Groupings Match Genetic Profiles.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
State Dept. Provides Preview of Life in Aztlan.htm |
HTML File |
24 KB |
Oct 2 2012 12:29 AM |
stayawayfromblackdoctors.html |
HTML File |
5.1 KB |
Oct 2 2012 12:32 AM |
Steve E Romer - 2006-04-18 - Make Illegal Aliens Felons - That's Not Enough.htm |
HTML File |
23.6 KB |
Oct 2 2012 12:28 AM |
Steven E. Roper - 2003-10-04 - Beyond IQ.txt |
Text File |
9.3 KB |
Oct 2 2012 12:33 AM |
Steven E. Roper - 2004-12-11 - White People's Music; White People's Religion.txt |
Text File |
18.3 KB |
Oct 2 2012 12:31 AM |
Steven E Romer - 2006-02-14 - Tiny Differences, Through Time, are Everything.htm |
HTML File |
30.2 KB |
Oct 2 2012 12:28 AM |
Stopping the Unstoppable.htm |
HTML File |
23.8 KB |
Oct 2 2012 12:33 AM |
Stop White Genocide.htm |
HTML File |
26.6 KB |
Oct 2 2012 12:31 AM |
StrangeLifeOfNikolaTesla.pdf |
PDF Document |
284.3 KB |
Oct 2 2012 12:30 AM |
Strangers Among Us.htm |
HTML File |
55.6 KB |
Oct 2 2012 12:34 AM |
Strong Showing for BNP.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
stupidwhitemen.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:27 AM |
stylesheet.css |
Stylesheet |
5.1 KB |
Oct 2 2012 12:31 AM |
Subverting the Disney Legacy - Michael Eisner.htm |
HTML File |
16.3 KB |
Oct 2 2012 12:30 AM |
Supermob - Sidney Korshak and His Criminal Associates.htm |
HTML File |
5 KB |
Oct 2 2012 12:29 AM |
Support Freedom of Speech - Wear the Wristband.htm |
HTML File |
5 KB |
Oct 2 2012 12:33 AM |
Surrounded by Jews, Bush Blasts Mahathir, Says He's 'Wrong' About Jewish Power.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:28 AM |
Survey - Israel is Number One Threat to World Peace.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:31 AM |
Suspect - My Job Is 'Taking White People's Cars'.htm |
HTML File |
11.5 KB |
Oct 2 2012 12:32 AM |
Sustainable_Design_Goals.pdf |
PDF Document |
485.6 KB |
Oct 2 2012 12:31 AM |
swazi.ttf |
TTF File |
46.1 KB |
Oct 2 2012 12:32 AM |
Swedes Arrest Alleged 'Anti-Fascist' Terrorist.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:34 AM |
Swedes Embrace Inquisition.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:27 AM |
Swiss Banks and the Jews - What Happened to the Extra Billion.htm |
HTML File |
11.9 KB |
Oct 2 2012 12:28 AM |
Synagogue Desecration Shocks London.htm |
HTML File |
7.3 KB |
Oct 2 2012 12:31 AM |
Syrians Snuff Islamist Attack on US.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:28 AM |
t.zip |
ZIP Archive |
2.1 MB |
Oct 2 2012 12:34 AM |
Take Me to Your Moron.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:28 AM |
TakeYourChoice.pdf |
PDF Document |
575.2 KB |
Oct 2 2012 12:31 AM |
TaliessinThroughLoegres.pdf |
PDF Document |
96.8 KB |
Oct 2 2012 12:28 AM |
Tampa - When Whites Gather.htm |
HTML File |
7.5 KB |
Oct 2 2012 12:30 AM |
Tampa Summer Solstice Festival.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:34 AM |
Targetmaster.pdf |
PDF Document |
27.8 KB |
Oct 2 2012 12:32 AM |
TaxonomicConstruct.pdf |
PDF Document |
341.1 KB |
Oct 2 2012 12:33 AM |
teachertestshowswideracialgap.html |
HTML File |
6.3 KB |
Oct 2 2012 12:30 AM |
Television Pioneer Elma Farnsworth Dies at 98.htm |
HTML File |
9.5 KB |
Oct 2 2012 12:31 AM |
TerrorFree.pdf |
PDF Document |
505.3 KB |
Oct 2 2012 12:31 AM |
testscoreprobesought.html |
HTML File |
6.4 KB |
Oct 2 2012 12:30 AM |
Texas Papers Play Up 'Racial' Quotes by Candidate Friedman.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:30 AM |
TextbookOfTheUniverse.pdf |
PDF Document |
12.3 MB |
Oct 2 2012 12:33 AM |
tfh.pdf |
PDF Document |
3.7 MB |
Oct 2 2012 12:30 AM |
tfh.zip |
ZIP Archive |
2.4 MB |
Oct 2 2012 12:30 AM |
That Which is Good, Shall be Called Evil.htm |
HTML File |
9.3 KB |
Oct 2 2012 12:33 AM |
thcov.pdf |
PDF Document |
812.1 KB |
Oct 2 2012 12:28 AM |
The 'Holocaust' Is A Typical Zionist Myth.htm |
HTML File |
49 KB |
Oct 2 2012 12:28 AM |
THE 100% SOLUTION.pdf |
PDF Document |
85.7 KB |
Oct 2 2012 12:28 AM |
The ADL, Jesus, and Anti-Semitism.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:33 AM |
The American Nation.htm |
HTML File |
19.4 KB |
Oct 2 2012 12:31 AM |
The American Nation Part II.htm |
HTML File |
17.5 KB |
Oct 2 2012 12:34 AM |
The Anthrax Murders - The Israeli Connection, part 1.htm |
HTML File |
25 KB |
Oct 2 2012 12:31 AM |
The Anthrax Murders - The Israeli Connection, part 2.htm |
HTML File |
23.6 KB |
Oct 2 2012 12:32 AM |
The Anti-White Gangsters of Ulster.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:28 AM |
TheAntichrist.pdf |
PDF Document |
164.5 KB |
Oct 2 2012 12:32 AM |
THE ARYANS, OR NOBLES.htm |
HTML File |
11.2 KB |
Oct 2 2012 12:34 AM |
The Barack Obama Myth.htm |
HTML File |
7.5 KB |
Oct 2 2012 12:28 AM |
The BBC's One Way Racism.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:33 AM |
The Beast as Saint - The Truth About 'Martin Luther King'.htm |
HTML File |
22.8 KB |
Oct 2 2012 12:33 AM |
The Biological Puzzle of Jewish Behavior.htm |
HTML File |
12.2 KB |
Oct 2 2012 12:30 AM |
The Broken Wall - newspaper coverage of its advertisers.txt |
Text File |
23.9 KB |
Oct 2 2012 12:29 AM |
thecause.pdf |
PDF Document |
166 KB |
Oct 2 2012 12:29 AM |
The Changing Face of AIDS.htm |
HTML File |
17.8 KB |
Oct 2 2012 12:32 AM |
THE CHINK IN OUR ARMOR.htm |
HTML File |
19.9 KB |
Oct 2 2012 12:30 AM |
The Christ-Killers Today.htm |
HTML File |
22 KB |
Oct 2 2012 12:32 AM |
The Color Of Crime And The New Orleans Nightmare.htm |
HTML File |
13.2 KB |
Oct 2 2012 12:27 AM |
TheComingBattle.pdf |
PDF Document |
728.1 KB |
Oct 2 2012 12:30 AM |
The Confederate Defeat, The Fall Of New Orleans.htm |
HTML File |
44 KB |
Oct 2 2012 12:31 AM |
The Congo's Atrocious Secret.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:34 AM |
thecoxreport.html |
HTML File |
10 KB |
Oct 2 2012 12:33 AM |
The Darkening Face of AIDS.htm |
HTML File |
1.7 KB |
Oct 2 2012 12:34 AM |
The Dark Side of the Anti-Defamation League, part 1.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:31 AM |
The Dark Side of the Anti-Defamation League, part 2.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:30 AM |
The Dark Side of the Anti-Defamation League, part 3.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:33 AM |
The Dark Side of the Anti-Defamation League, part 4.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:33 AM |
The Dark Side of the Anti-Defamation League, part 5.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:28 AM |
The Dark Side of the Anti-Defamation League, part 6.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:33 AM |
The Dark Side of the Anti-Defamation League, part 7.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:31 AM |
The Dark Side of the Anti-Defamation League, part 8.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:34 AM |
The De-Zionization of the American Mind.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:30 AM |
The Deadly Twins.htm |
HTML File |
10.8 KB |
Oct 2 2012 12:33 AM |
The Destruction of White Youth.htm |
HTML File |
3 KB |
Oct 2 2012 12:33 AM |
The Dog Gone Asians.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:31 AM |
The Drunken Truth.htm |
HTML File |
18 KB |
Oct 2 2012 12:30 AM |
The Dutch Say 'Nee!'.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:28 AM |
The Eternal Value of Privacy.htm |
HTML File |
24.5 KB |
Oct 2 2012 12:30 AM |
The EU Constitution.htm |
HTML File |
6 KB |
Oct 2 2012 12:27 AM |
The Evidence of the Prussian Blue.htm |
HTML File |
14.5 KB |
Oct 2 2012 12:31 AM |
The Factory Farms of Jewish Publishing.htm |
HTML File |
14.8 KB |
Oct 2 2012 12:30 AM |
The FCC Scandal.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:27 AM |
The Forbidden Srebrenica Report - Something The Neo-cons Don't Want You To See.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:32 AM |
The Fraud of Neoconservative 'Anti-Communism'.htm |
HTML File |
19.4 KB |
Oct 2 2012 12:32 AM |
The Gateway.htm |
HTML File |
19.6 KB |
Oct 2 2012 12:31 AM |
The Governors Declare An Emergency - Who Cares If They’re Sincere.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:29 AM |
The Hard Edge of Hatred.htm |
HTML File |
11 KB |
Oct 2 2012 12:32 AM |
The Hidden History of 9-11-2001.htm |
HTML File |
129.8 KB |
Oct 2 2012 12:28 AM |
The Hidden Tyranny.txt |
Text File |
49.5 KB |
Oct 2 2012 12:28 AM |
THE HIGH COST OF VENGEANCE.rtf |
RTF File |
906.3 KB |
Oct 2 2012 12:33 AM |
The Hollywood Big Lie.htm |
HTML File |
5.9 KB |
Oct 2 2012 12:28 AM |
The Holocaust Controversy - The Case For Open Debate.htm |
HTML File |
20.8 KB |
Oct 2 2012 12:33 AM |
The Holy Man and the Ho.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:27 AM |
TheInternationalJew.pdf |
PDF Document |
2.4 MB |
Oct 2 2012 12:30 AM |
TheJewAsCriminal.pdf |
PDF Document |
511.8 KB |
Oct 2 2012 12:31 AM |
The Jewish Declaration of War.htm |
HTML File |
33.2 KB |
Oct 2 2012 12:31 AM |
THE JEWS AND THE CONCENTRATION CAMPS - A FACTUAL APPRAISAL BY THE RED.htm |
HTML File |
16.2 KB |
Oct 2 2012 12:30 AM |
The Jew Who Fled Rio.htm |
HTML File |
18.5 KB |
Oct 2 2012 12:34 AM |
The Judas Goats.htm |
HTML File |
31.6 KB |
Oct 2 2012 12:31 AM |
TheJungle.pdf |
PDF Document |
815.9 KB |
Oct 2 2012 12:32 AM |
The Kwanzaa Hoax.htm |
HTML File |
13.1 KB |
Oct 2 2012 12:32 AM |
The Last Straw - Jewish Death Squads in America.htm |
HTML File |
18.1 KB |
Oct 2 2012 12:31 AM |
The Leo Frank case.htm |
HTML File |
56.9 KB |
Oct 2 2012 12:31 AM |
The Liberty Tree.htm |
HTML File |
6 KB |
Oct 2 2012 12:31 AM |
The Love of Ages.htm |
HTML File |
21.9 KB |
Oct 2 2012 12:31 AM |
The Meaning of the Candy Cane.txt |
Text File |
468 Bytes |
Oct 2 2012 12:31 AM |
The Middle East Initiative.htm |
HTML File |
18.3 KB |
Oct 2 2012 12:29 AM |
The Missiles at Ground Zero.htm |
HTML File |
20.8 KB |
Oct 2 2012 12:31 AM |
The Most Corrupt Member of Congress.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:31 AM |
The Neo-Genocidists.htm |
HTML File |
15.2 KB |
Oct 2 2012 12:34 AM |
The New Minority.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:28 AM |
The Next Victims of Islamic Terror.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:28 AM |
The Officially Sanctioned Invasion of Greece.htm |
HTML File |
21.6 KB |
Oct 2 2012 12:34 AM |
The Origins Of 'Racism' - The Curious Beginnings Of A Useless Word.htm |
HTML File |
53.2 KB |
Oct 2 2012 12:32 AM |
The Origins of the White Man - Part I.htm |
HTML File |
82.7 KB |
Oct 2 2012 12:31 AM |
The Origins of the White Man - Part II.htm |
HTML File |
85.1 KB |
Oct 2 2012 12:34 AM |
The Origins of the Word 'Racism'.htm |
HTML File |
18.6 KB |
Oct 2 2012 12:33 AM |
ThePhotographersRight.pdf |
PDF Document |
53.8 KB |
Oct 2 2012 12:27 AM |
The Pope Must Die.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:32 AM |
The Price White Americans Pay - Never Forget the Hmong Massacre.htm |
HTML File |
12.7 KB |
Oct 2 2012 12:33 AM |
The Price White Americans Pay - Never Forget the Hmong Massacre.pdf |
PDF Document |
320 KB |
Oct 2 2012 12:34 AM |
thequietscourge.html |
HTML File |
5 KB |
Oct 2 2012 12:31 AM |
The Racial Ideology of Empire.htm |
HTML File |
122.3 KB |
Oct 2 2012 12:31 AM |
The Rednecks Did It!.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:32 AM |
There is No Freedom Without Free Speech.htm |
HTML File |
14.3 KB |
Oct 2 2012 12:31 AM |
There is No Ghetto Pass.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:31 AM |
There is no place for such a regime in the family of nations.txt |
Text File |
4.1 KB |
Oct 2 2012 12:30 AM |
The Resurrector.pdf |
PDF Document |
135.9 KB |
Oct 2 2012 12:31 AM |
The Rise of the BNP.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:34 AM |
The Self-Evident Lessons of Madrid.htm |
HTML File |
8.3 KB |
Oct 2 2012 12:31 AM |
The Shame of Being an American.htm |
HTML File |
20.2 KB |
Oct 2 2012 12:28 AM |
The Shocking Story of Approved Killing in Mississippi.htm |
HTML File |
37.7 KB |
Oct 2 2012 12:29 AM |
The Struggle for Caucasia.htm |
HTML File |
15.8 KB |
Oct 2 2012 12:33 AM |
The Symbiants.htm |
HTML File |
8.3 KB |
Oct 2 2012 12:27 AM |
thetanserstudy.html |
HTML File |
7.8 KB |
Oct 2 2012 12:32 AM |
The Tapes the Hague Tribunal Hasn't Shown - Muslim Terrorists Massacring Serbs.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:31 AM |
The Truth About Slavery.htm |
HTML File |
23.4 KB |
Oct 2 2012 12:34 AM |
The Truth About Tuskegee.htm |
HTML File |
29 KB |
Oct 2 2012 12:29 AM |
The United Israeli Emirates of North America.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:32 AM |
The United States of Barbarism.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:34 AM |
TheWatchdogs.pdf |
PDF Document |
807.5 KB |
Oct 2 2012 12:28 AM |
TheWayForward.pdf |
PDF Document |
579.5 KB |
Oct 2 2012 12:32 AM |
The Weird Wild World of the Zionist Right.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:30 AM |
The Weird World of Kwanzaa and Other African Hoaxes.htm |
HTML File |
9.3 KB |
Oct 2 2012 12:33 AM |
The Whitewashing of Ariel Sharon.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:33 AM |
The Winds of Change.htm |
HTML File |
29.3 KB |
Oct 2 2012 12:28 AM |
The World is His China Shop and His Shills Make Excuses.htm |
HTML File |
9.7 KB |
Oct 2 2012 12:27 AM |
The Wrath of Ka.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:34 AM |
They Want Our Kids.htm |
HTML File |
2.2 KB |
Oct 2 2012 12:33 AM |
theywereslaves.pdf |
PDF Document |
3.3 MB |
Oct 2 2012 12:28 AM |
theywereslaves.rtf |
RTF File |
2.4 MB |
Oct 2 2012 12:28 AM |
The Zambotistas and the Moslemoids versus the Neo-Cons.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:34 AM |
The_Jews_in_England_part2.html |
HTML File |
38.3 KB |
Oct 2 2012 12:28 AM |
the_talmud.pdf |
PDF Document |
199.5 KB |
Oct 2 2012 12:33 AM |
the_truth.pdf |
PDF Document |
280.2 KB |
Oct 2 2012 12:34 AM |
thinking.htm |
HTML File |
24.9 KB |
Oct 2 2012 12:33 AM |
ThinkingAboutNeocons.pdf |
PDF Document |
147.4 KB |
Oct 2 2012 12:30 AM |
ThisTimeTheWorld.pdf |
PDF Document |
594.1 KB |
Oct 2 2012 12:33 AM |
ThisTimeTheWorld.rtf |
RTF File |
1.1 MB |
Oct 2 2012 12:27 AM |
This Will Come Back to Haunt Us.htm |
HTML File |
9.6 KB |
Oct 2 2012 12:31 AM |
Thomas Carlyle and Edward Bulwer-Lytton - Giants of the North.htm |
HTML File |
50.6 KB |
Oct 2 2012 12:27 AM |
Thomas Jefferson - Letter to the Secretary of the Treasury Albert Gallatin.txt |
Text File |
756 Bytes |
Oct 2 2012 12:33 AM |
Thomas W. Chittum - Civil War II.pdf |
PDF Document |
2.3 MB |
Oct 2 2012 12:28 AM |
thousandsattendvoodoofestival.html |
HTML File |
4 KB |
Oct 2 2012 12:33 AM |
Thousands Protest Violence in Darfur.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:33 AM |
Threats to a Free Internet.htm |
HTML File |
17.2 KB |
Oct 2 2012 12:27 AM |
ThunderDome.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:33 AM |
ThusSpakeZarathustra.pdf |
PDF Document |
917.3 KB |
Oct 2 2012 12:33 AM |
tiffany_long.pdf |
PDF Document |
497.5 KB |
Oct 2 2012 12:33 AM |
tilak-pdf.zip |
ZIP Archive |
1.6 MB |
Oct 2 2012 12:30 AM |
Tiny Differences, Through Time, are Everything.htm |
HTML File |
30.2 KB |
Oct 2 2012 12:31 AM |
tipsforthewrittenexamination.pdf |
PDF Document |
170.4 KB |
Oct 2 2012 12:30 AM |
tob_shebbe_goyim_harog_first6.pdf |
PDF Document |
757.5 KB |
Oct 2 2012 12:31 AM |
Today Show - Let 'Em Eat Cake.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:33 AM |
Tolerance.pdf |
PDF Document |
177.3 KB |
Oct 2 2012 12:33 AM |
Tolerance.zip |
ZIP Archive |
76.6 KB |
Oct 2 2012 12:31 AM |
Tom Quick (1851) JR.pdf |
PDF Document |
459.2 KB |
Oct 2 2012 12:28 AM |
Tonight - Current Issues TV to Host Dr. David Duke.htm |
HTML File |
3.6 KB |
Oct 2 2012 12:34 AM |
Toni Morrison - She Simply Can't Write.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:33 AM |
Tookie's 'Peaceful' Pals Threaten Violence.htm |
HTML File |
3 KB |
Oct 2 2012 12:30 AM |
Tookie Advocate - 'That’s a racist question!'.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:31 AM |
Tookie Finally Ready to Snitch.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:34 AM |
Too White, Too Strong.htm |
HTML File |
9.2 KB |
Oct 2 2012 12:28 AM |
too_white.pdf |
PDF Document |
455.6 KB |
Oct 2 2012 12:33 AM |
too_white_sm.pdf |
PDF Document |
459.6 KB |
Oct 2 2012 12:33 AM |
Top Rabbi - Katrina is God's Punishment for Not Supporting Israel.htm |
HTML File |
2.7 KB |
Oct 2 2012 12:29 AM |
tor2005-224.pdf |
PDF Document |
188.7 KB |
Oct 2 2012 12:34 AM |
Toronto Rampage Flyer.pdf |
PDF Document |
51.3 KB |
Oct 2 2012 12:29 AM |
Tourists Evacuated from Superdome.htm |
HTML File |
3 KB |
Oct 2 2012 12:30 AM |
Tourists Targeted in New Orleans as Unrest Spreads to Baton Rouge.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:33 AM |
traffic.pdf |
PDF Document |
418.6 KB |
Oct 2 2012 12:28 AM |
Troops Back From Iraq Find Another War Zone.htm |
HTML File |
13.9 KB |
Oct 2 2012 12:28 AM |
Troops Find Grisly Scenes in New Orleans Convention Center.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:33 AM |
trr.pdf |
PDF Document |
4.2 MB |
Oct 2 2012 12:31 AM |
trr.zip |
ZIP Archive |
1.4 MB |
Oct 2 2012 12:32 AM |
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast.htm |
HTML File |
145.1 KB |
Oct 2 2012 12:31 AM |
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast2.htm |
HTML File |
143 KB |
Oct 2 2012 12:27 AM |
Turkey, EU Reach Deal for Opening Talks.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:29 AM |
Turkey Has No Friends; Good for Europe.htm |
HTML File |
5.4 KB |
Oct 2 2012 12:30 AM |
Turkey Wins Censorship of Armenian Genocide in German Schools.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:33 AM |
Turkish Novelist Faces Jail for ‘Hate Speech’.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:33 AM |
Turks Award Zionists with Weapons Contract.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:34 AM |
Turks Convict Armenian Journalist of 'Speech Crime'.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:30 AM |
Turks May Save Drowning Rat.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:28 AM |
TurnerDiaries.pdf |
PDF Document |
809.7 KB |
Oct 2 2012 12:32 AM |
TurnerDiaries.rtf |
RTF File |
1.9 MB |
Oct 2 2012 12:31 AM |
turnerdiaries.zip |
ZIP Archive |
279 KB |
Oct 2 2012 12:34 AM |
turn_it_down_resource_kit.pdf |
PDF Document |
507.9 KB |
Oct 2 2012 12:28 AM |
Two More 'Sexual Indoctrination' Bills Vetoed.htm |
HTML File |
3 KB |
Oct 2 2012 12:27 AM |
TWPL_Final.pdf |
PDF Document |
3 MB |
Oct 2 2012 12:33 AM |
U.S. Population Nears 300 Million.htm |
HTML File |
5.4 KB |
Oct 2 2012 12:31 AM |
U.S.S. Liberty,.html |
HTML File |
56.9 KB |
Oct 2 2012 12:33 AM |
U.S.S. Liberty Crew Reunites.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:33 AM |
U.S. State Department - Israel Plagued by Trafficking.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:31 AM |
Ugly Lessons from Katrina.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:28 AM |
UK - Al Qaeda 'Cleric' Worked for Both Sides.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:32 AM |
UK - Birmingham Riots Result of Multicultural Experiment.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:32 AM |
UK - Black Gets Prison for al-Qaeda Plot.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:33 AM |
UK - BNP Music Label Launched.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:28 AM |
UK - BNP Picking Up Votes - Viewed as Persecuted Underdog.htm |
HTML File |
5 KB |
Oct 2 2012 12:32 AM |
UK - British National Party Chairman Nick Griffin Released.htm |
HTML File |
7.1 KB |
Oct 2 2012 12:29 AM |
UK - Censorship by Multiracialists Raises Ugly Head.htm |
HTML File |
4.6 KB |
Oct 2 2012 12:32 AM |
UK - Conservatives Fear Nationalist Competition.htm |
HTML File |
7.5 KB |
Oct 2 2012 12:31 AM |
UK - English Town Continues to Suffer From Multiracialism.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:31 AM |
UK - Jews Condemned for Throat-Cutting Ritual.htm |
HTML File |
1.7 KB |
Oct 2 2012 12:31 AM |
UK - Keighley Protest Still On.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:29 AM |
UK - Muslims Scream About Ice Cream.htm |
HTML File |
4.7 KB |
Oct 2 2012 12:31 AM |
UK - National Demonstration Against Police Anti-White Racism Planned.htm |
HTML File |
7.6 KB |
Oct 2 2012 12:28 AM |
UK - Nov. 2 Free Speech Demo Plan Forges Ahead.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:28 AM |
UK - Now It's Griffin.htm |
HTML File |
12.3 KB |
Oct 2 2012 12:31 AM |
UK - Police Arrest Anti-White Goon.htm |
HTML File |
4 KB |
Oct 2 2012 12:33 AM |
UK - Police Investigating Multiracialist Entertainer for Threatening Whites.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:27 AM |
UK - Popular Muslim Video Supports Violence Against Non-Believers.htm |
HTML File |
4.3 KB |
Oct 2 2012 12:33 AM |
UK - Race Rioting Erupts in Birmingham.htm |
HTML File |
13.5 KB |
Oct 2 2012 12:31 AM |
UK - Racial Justice Sunday Staged by Rapidly Shrinking Church.htm |
HTML File |
7.8 KB |
Oct 2 2012 12:31 AM |
UK - Secret Police Seize Nationalist Paper.htm |
HTML File |
10.6 KB |
Oct 2 2012 12:30 AM |
UK - Top Cop Urges Police To Wear Islamic Battle Colors.htm |
HTML File |
7.2 KB |
Oct 2 2012 12:30 AM |
UK - White Leaders Undaunted by Coordinated Violent Attacks.htm |
HTML File |
4 KB |
Oct 2 2012 12:30 AM |
UK - Whites Furious Over Removal of Memorial To Slain Teenager.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:28 AM |
UK - Whites Quitting Cities.htm |
HTML File |
3.5 KB |
Oct 2 2012 12:33 AM |
UK = Church Anger at Islamic Texts.htm |
HTML File |
4.4 KB |
Oct 2 2012 12:33 AM |
UK Cops Threaten Vet Over Flag.htm |
HTML File |
9.7 KB |
Oct 2 2012 12:31 AM |
UK journalist arrested in Israel.htm |
HTML File |
5.1 KB |
Oct 2 2012 12:33 AM |
Ukraine - David Duke Earns Doctorate in History.htm |
HTML File |
12.5 KB |
Oct 2 2012 12:33 AM |
Ulster - Anti-White Loyalist Thug Slain.htm |
HTML File |
7.4 KB |
Oct 2 2012 12:32 AM |
Ulster - Loyalists Join Jews in Human Smuggling Ring.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:27 AM |
Ulster - Religious Fanatics Say No To Catholics, Yes To Non-Whites.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:27 AM |
Ulster-Scots Culture Enjoys a Renaissance.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
ulysses.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:30 AM |
ulysses.rtf |
RTF File |
3.9 MB |
Oct 2 2012 12:30 AM |
UMBCTeenDrivingStudy.pdf |
PDF Document |
473.9 KB |
Oct 2 2012 12:33 AM |
UN Antislavery Day Celebrates Massacre of Whites.htm |
HTML File |
3 KB |
Oct 2 2012 12:27 AM |
UnderstandingJewInfluence.pdf |
PDF Document |
240.2 KB |
Oct 2 2012 12:33 AM |
Underst_White_Priv.pdf |
PDF Document |
1002 KB |
Oct 2 2012 12:27 AM |
UniqueWesternCulture.pdf |
PDF Document |
136.8 KB |
Oct 2 2012 12:28 AM |
Updated - Who Rules America.htm |
HTML File |
50 KB |
Oct 2 2012 12:30 AM |
upperclassblackstudentsunderperforming.html |
HTML File |
7.1 KB |
Oct 2 2012 12:33 AM |
Uprising.pdf |
PDF Document |
2.5 MB |
Oct 2 2012 12:32 AM |
urban guerilla.pdf |
PDF Document |
73.2 KB |
Oct 2 2012 12:31 AM |
US - White Poverty Soars.htm |
HTML File |
2.4 KB |
Oct 2 2012 12:32 AM |
usbegsjewstostopsellingmilitarytechnologytochina.html |
HTML File |
3.4 KB |
Oct 2 2012 12:32 AM |
uscollegetestatcenterofracechargeddebate.html |
HTML File |
5.8 KB |
Oct 2 2012 12:31 AM |
US Condemns 14 Countries for Human Trafficking.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:33 AM |
US Evangelicals Increasingly Question Pro-Zionist Heresy.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:28 AM |
US Iraq Atrocities Nothing New.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:31 AM |
US Left - Tools of Oligarchs, Zionists, System.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:31 AM |
US Nationalists Record Song for BNP.htm |
HTML File |
3.3 KB |
Oct 2 2012 12:29 AM |
US Provided KLA With Food.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:28 AM |
usseekstocurbisraeliarmssalestochina.html |
HTML File |
15.3 KB |
Oct 2 2012 12:33 AM |
USS LIBERTY Memorial - AMERICAN LEADERS SUPPORT USS Liberty SURVIVORS.htm |
HTML File |
84 KB |
Oct 2 2012 12:28 AM |
USS Liberty Veterans Present Pentagon With Report on Israeli War Crimes.htm |
HTML File |
33.2 KB |
Oct 2 2012 12:31 AM |
ustechnologyappearsinnewchinesewarplaneviaisrael.html |
HTML File |
12.4 KB |
Oct 2 2012 12:27 AM |
Usury Perfected.htm |
HTML File |
2.1 KB |
Oct 2 2012 12:28 AM |
Utahns Leaving Multiracial Public Schools.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:30 AM |
V-News.org Exclusive - The Plan De San Diego.htm |
HTML File |
6.3 KB |
Oct 2 2012 12:31 AM |
Vang Guilty in Hunter Massacre Trial.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:30 AM |
Vang Says Three Hunters Deserved to Die.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:34 AM |
Vanguard News Network » Blog Archive » Important Thoughts, Financial and Economic Advice.htm |
HTML File |
115.3 KB |
Oct 2 2012 12:30 AM |
Vanunu - Israel's Nuclear Arsenal a Threat to Middle East.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:32 AM |
vargsmal.zip |
ZIP Archive |
101.3 KB |
Oct 2 2012 12:33 AM |
Venezuelan Chavez wants to be world's anti-U.S. voice.htm |
HTML File |
10.3 KB |
Oct 2 2012 12:30 AM |
Veteran Congressman Paul Findley Exposes Israel’s Lobby.htm |
HTML File |
7.3 KB |
Oct 2 2012 12:32 AM |
vfsky.pdf |
PDF Document |
82.6 KB |
Oct 2 2012 12:31 AM |
VH.zip |
ZIP Archive |
1.9 MB |
Oct 2 2012 12:31 AM |
video.html |
HTML File |
49.8 KB |
Oct 2 2012 12:32 AM |
Vigilantes Attack Elderly Border Protestors.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:33 AM |
Viktor Schauberger.txt |
Text File |
11.1 KB |
Oct 2 2012 12:33 AM |
Viroqua, WI School Board Bans 'Diversity Day'.htm |
HTML File |
6 KB |
Oct 2 2012 12:31 AM |
VirusHouse.pdf |
PDF Document |
2 MB |
Oct 2 2012 12:31 AM |
vnntaa1a.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:33 AM |
vnntaa2.pdf |
PDF Document |
1.7 MB |
Oct 2 2012 12:32 AM |
vnntaa3.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:28 AM |
Vof64-1.pdf |
PDF Document |
1.6 MB |
Oct 2 2012 12:31 AM |
Vof64-2.pdf |
PDF Document |
629.4 KB |
Oct 2 2012 12:31 AM |
Vof64-3.pdf |
PDF Document |
649.3 KB |
Oct 2 2012 12:28 AM |
Vof64-4.pdf |
PDF Document |
915.2 KB |
Oct 2 2012 12:31 AM |
Vof64-5.pdf |
PDF Document |
344.4 KB |
Oct 2 2012 12:27 AM |
Vof64-6.pdf |
PDF Document |
543.3 KB |
Oct 2 2012 12:33 AM |
Vof64-7.pdf |
PDF Document |
564 KB |
Oct 2 2012 12:31 AM |
Vof64-8.pdf |
PDF Document |
8 MB |
Oct 2 2012 12:28 AM |
Vof64-9.pdf |
PDF Document |
8.6 MB |
Oct 2 2012 12:34 AM |
Vof64-10.pdf |
PDF Document |
655.5 KB |
Oct 2 2012 12:27 AM |
Vof64-11.pdf |
PDF Document |
831.1 KB |
Oct 2 2012 12:32 AM |
Vof64-12.pdf |
PDF Document |
462.8 KB |
Oct 2 2012 12:28 AM |
Vof64-13.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:33 AM |
Vof64-14.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:33 AM |
Vof64-15.pdf |
PDF Document |
2.1 MB |
Oct 2 2012 12:34 AM |
Vof64-16.pdf |
PDF Document |
3.2 MB |
Oct 2 2012 12:28 AM |
Voice For Europe - Pan-European Co-ordination Against Turkish EU Membership.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:27 AM |
Voices from the Past - Languages of Our Ancestors.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:31 AM |
Voodoo Faithful on Annual Pilgrimage.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:34 AM |
Voting for Pro-White Parties Is 'Spitting in God's Face'.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:33 AM |
Wal-Mart Turns in Student’s Anti-Bush Photo, Secret Service Investigates Him.htm |
HTML File |
4 KB |
Oct 2 2012 12:30 AM |
Wales - Win for 'Heretic'.htm |
HTML File |
4.2 KB |
Oct 2 2012 12:33 AM |
WalkerIndictment.pdf |
PDF Document |
149.5 KB |
Oct 2 2012 12:33 AM |
WallStreetCommieRevolution.pdf |
PDF Document |
586.2 KB |
Oct 2 2012 12:31 AM |
WarBetweenGenerals.pdf |
PDF Document |
3.6 MB |
Oct 2 2012 12:33 AM |
War Criminal at Bay.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:31 AM |
WarIsARacket.pdf |
PDF Document |
42.6 KB |
Oct 2 2012 12:30 AM |
War Party Atrocity Porn.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:30 AM |
WarPath.pdf |
PDF Document |
2.4 MB |
Oct 2 2012 12:31 AM |
War Signals.htm |
HTML File |
2.9 KB |
Oct 2 2012 12:32 AM |
WAR_AryanUpdates2003_02_01_00_99.pdf |
PDF Document |
3.4 MB |
Oct 2 2012 12:31 AM |
WAR_AryanUpdates2004_03_02.pdf |
PDF Document |
3.3 MB |
Oct 2 2012 12:31 AM |
Was Columbus Greek.htm |
HTML File |
6 KB |
Oct 2 2012 12:31 AM |
WAS THERE REALLY A HOLOCAUST.htm |
HTML File |
19.7 KB |
Oct 2 2012 12:28 AM |
Was WWII Worth It.htm |
HTML File |
6.7 KB |
Oct 2 2012 12:29 AM |
WATCHING.pdf |
PDF Document |
80.6 KB |
Oct 2 2012 12:27 AM |
Watts Riots 40 Years On.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:33 AM |
wausau.htm |
HTML File |
38.7 KB |
Oct 2 2012 12:32 AM |
WausauImmigration.pdf |
PDF Document |
38.5 KB |
Oct 2 2012 12:30 AM |
WausauImmigration.rtf |
RTF File |
64 KB |
Oct 2 2012 12:28 AM |
WealthOfNations.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:28 AM |
We at The Scriptorium.htm |
HTML File |
15.5 KB |
Oct 2 2012 12:33 AM |
weekly report 01.pdf |
PDF Document |
363.3 KB |
Oct 2 2012 12:31 AM |
Welcome, TAA#3 readers - Background on our authors subjects.htm |
HTML File |
71.3 KB |
Oct 2 2012 12:33 AM |
Welcome News - Turks May 'Shun' EU Talks.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:31 AM |
Welcome to the Jungle - Superdome Tales.htm |
HTML File |
3 KB |
Oct 2 2012 12:31 AM |
Wendy Campbell - 2006-09-11 - Parallels between Nazism, Zionists striking.htm |
HTML File |
29.5 KB |
Oct 2 2012 12:30 AM |
We The People.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:33 AM |
What's in the New Orleans Water.htm |
HTML File |
5.5 KB |
Oct 2 2012 12:29 AM |
What's This About 'Peak Oil'.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:33 AM |
What's Your Diversity Quotient.htm |
HTML File |
15.1 KB |
Oct 2 2012 12:31 AM |
What About 'Affirmative Action' for US Media Ownership.htm |
HTML File |
15.4 KB |
Oct 2 2012 12:28 AM |
What Does Israel Want.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:31 AM |
What is National Vanguard - intro.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:32 AM |
What is National Vanguard.htm |
HTML File |
22.7 KB |
Oct 2 2012 12:31 AM |
What is So Wrong With White People.htm |
HTML File |
8.2 KB |
Oct 2 2012 12:31 AM |
What Makes Palestinians Think They Can.htm |
HTML File |
7.6 KB |
Oct 2 2012 12:28 AM |
What Makes Western Culture Unique.htm |
HTML File |
4.8 KB |
Oct 2 2012 12:29 AM |
whatsnew.htm |
HTML File |
6.4 KB |
Oct 2 2012 12:28 AM |
WhatTheTalmudTeaches.pdf |
PDF Document |
213 KB |
Oct 2 2012 12:34 AM |
What will become of the ‘American Dream’.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:31 AM |
What Would War Look Like.htm |
HTML File |
5.4 KB |
Oct 2 2012 12:32 AM |
Wheat and Chaff.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:33 AM |
When Al Qaeda Was An Ally of 'the West'.htm |
HTML File |
4.7 KB |
Oct 2 2012 12:31 AM |
When In Our Music God Is Glorified.doc |
Microsoft Word Document |
20.5 KB |
Oct 2 2012 12:27 AM |
where_are_wmd.pdf |
PDF Document |
92 KB |
Oct 2 2012 12:31 AM |
Which Way, Milwaukee.htm |
HTML File |
14.8 KB |
Oct 2 2012 12:31 AM |
WhiteAmerica.pdf |
PDF Document |
527.7 KB |
Oct 2 2012 12:32 AM |
White America starts winning.htm |
HTML File |
7 KB |
Oct 2 2012 12:31 AM |
White Children Experience Slavery at Summer Camp.htm |
HTML File |
3 KB |
Oct 2 2012 12:30 AM |
White Heritage Sites Threatened on Cyprus.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:33 AM |
White India.htm |
HTML File |
4.7 KB |
Oct 2 2012 12:27 AM |
White Interests.htm |
HTML File |
3.1 KB |
Oct 2 2012 12:33 AM |
WhiteMansBibleOrig.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:28 AM |
White Nationalist Position Statements.pdf |
PDF Document |
55.7 KB |
Oct 2 2012 12:27 AM |
White Nationalist Position Statements.txt |
Text File |
7 KB |
Oct 2 2012 12:30 AM |
White People's Party Forms in Nevada.htm |
HTML File |
5.4 KB |
Oct 2 2012 12:34 AM |
WhitePower.pdf |
PDF Document |
766.1 KB |
Oct 2 2012 12:27 AM |
whitesblacks100factsandonelie.html |
HTML File |
62.2 KB |
Oct 2 2012 12:31 AM |
White Science, Black Humor.htm |
HTML File |
13.7 KB |
Oct 2 2012 12:30 AM |
WhiteSlaveryBibliography.pdf |
PDF Document |
72.1 KB |
Oct 2 2012 12:27 AM |
White Slavery Focus of New Book.htm |
HTML File |
2.6 KB |
Oct 2 2012 12:32 AM |
Whites Make Stand at Superdome.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:31 AM |
Whites Organize in Namibia.htm |
HTML File |
2.8 KB |
Oct 2 2012 12:31 AM |
Whites Repulse Turks in Georgian Waters.htm |
HTML File |
5.3 KB |
Oct 2 2012 12:33 AM |
Whites Suffering in New Orleans.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:27 AM |
White Teen Dragged from Bus, Beaten, and Robbed by Anti-White Gang Members.htm |
HTML File |
2.3 KB |
Oct 2 2012 12:31 AM |
White Wire Newsblog » A History of Kwanza by Ann Coulter…and a Special Kwanza Jingle From the White Wire Staff.htm |
HTML File |
20.7 KB |
Oct 2 2012 12:33 AM |
Who Brought the Slaves to America -- part II of II.htm |
HTML File |
28.4 KB |
Oct 2 2012 12:31 AM |
Who Brought the Slaves to America -- part I of II.htm |
HTML File |
20.7 KB |
Oct 2 2012 12:31 AM |
Who Rules America.htm |
HTML File |
49.6 KB |
Oct 2 2012 12:32 AM |
WhoRulesAmerica.pdf |
PDF Document |
51.2 KB |
Oct 2 2012 12:31 AM |
Who We Sold the Serbs To.htm |
HTML File |
6.6 KB |
Oct 2 2012 12:33 AM |
WhoWillFeedChina.pdf |
PDF Document |
43.5 KB |
Oct 2 2012 12:30 AM |
whydoblackstudentslagbehind.html |
HTML File |
15.7 KB |
Oct 2 2012 12:28 AM |
Why Hitler Attacked Soviet Russia When He Did.htm |
HTML File |
31.5 KB |
Oct 2 2012 12:31 AM |
whyisafricapoor.html |
HTML File |
19.7 KB |
Oct 2 2012 12:28 AM |
Why Islam Didn't Conquer the World.htm |
HTML File |
6.6 KB |
Oct 2 2012 12:30 AM |
Why Israel’s Campaign in Lebanon is Failing.htm |
HTML File |
8.8 KB |
Oct 2 2012 12:33 AM |
Why Scandinavia Tops U.N. Standard of Living Index.htm |
HTML File |
3.8 KB |
Oct 2 2012 12:31 AM |
why_reverse_evolution.pdf |
PDF Document |
209.4 KB |
Oct 2 2012 12:33 AM |
why_reverse_evolution_color.pdf |
PDF Document |
629.2 KB |
Oct 2 2012 12:34 AM |
WichitaMassacre.pdf |
PDF Document |
520.3 KB |
Oct 2 2012 12:28 AM |
WichitaMassacreHomepage.pdf |
PDF Document |
957.5 KB |
Oct 2 2012 12:30 AM |
wiesenthal - fake holocaust.htm |
HTML File |
15.9 KB |
Oct 2 2012 12:27 AM |
Wife-Beating Drug Addict Demands Custody Of Prussian Blue.txt |
Text File |
2.2 KB |
Oct 2 2012 12:30 AM |
Wife19.pdf |
PDF Document |
8.1 MB |
Oct 2 2012 12:33 AM |
WinterSonnenWend.pdf |
PDF Document |
1.5 MB |
Oct 2 2012 12:31 AM |
wiretap.pdf |
PDF Document |
453.6 KB |
Oct 2 2012 12:29 AM |
Wisconsin - New Flood of Hmong Refugees Will Strain Already Tight Budgets.htm |
HTML File |
5.7 KB |
Oct 2 2012 12:33 AM |
Wisconsin - Rampage Killer, Friends Now Suspects in 2001 Homicide.htm |
HTML File |
7.1 KB |
Oct 2 2012 12:27 AM |
Wisconsin Loves Its Non-Whites Too.htm |
HTML File |
5.8 KB |
Oct 2 2012 12:31 AM |
Witnesses - New Orleans Cops are Looters.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:28 AM |
WKRC_UAS.wmv |
WMV File |
5.8 MB |
Oct 2 2012 12:28 AM |
wmb.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:31 AM |
wn-urls.txt |
Text File |
4.7 KB |
Oct 2 2012 12:33 AM |
wood103.pdf |
PDF Document |
196.8 KB |
Oct 2 2012 12:31 AM |
Worldwide Lack of Concern Over Israel's White Slave Trade.htm |
HTML File |
4.5 KB |
Oct 2 2012 12:33 AM |
WPP Guidelines.pdf |
PDF Document |
21.3 KB |
Oct 2 2012 12:33 AM |
WPP Petition.pdf |
PDF Document |
723.2 KB |
Oct 2 2012 12:27 AM |
WPP Platform.pdf |
PDF Document |
57.5 KB |
Oct 2 2012 12:31 AM |
wra.pdf |
PDF Document |
289.2 KB |
Oct 2 2012 12:31 AM |
wra2004.pdf |
PDF Document |
899.9 KB |
Oct 2 2012 12:32 AM |
wraflyer.pdf |
PDF Document |
45.4 KB |
Oct 2 2012 12:32 AM |
WSCwrote1920.html |
HTML File |
11.1 KB |
Oct 2 2012 12:33 AM |
wtc1.pdf |
PDF Document |
5.3 MB |
Oct 2 2012 12:31 AM |
WTC 911 plot.pdf |
PDF Document |
334.7 KB |
Oct 2 2012 12:31 AM |
WTC_1page.pdf |
PDF Document |
5.3 MB |
Oct 2 2012 12:33 AM |
wvr.pdf |
PDF Document |
13.2 MB |
Oct 2 2012 12:34 AM |
yellow.pdf |
PDF Document |
1 MB |
Oct 2 2012 12:33 AM |
YGGDRASIL - Lesson Number One.htm |
HTML File |
21.4 KB |
Oct 2 2012 12:27 AM |
YggdrasilsLibrary.pdf |
PDF Document |
3.1 MB |
Oct 2 2012 12:30 AM |
YggLibraryFull.pdf |
PDF Document |
4.3 MB |
Oct 2 2012 12:31 AM |
youre_fired.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:28 AM |
Youth Gang Rape Reported in Milwaukee.htm |
HTML File |
6.5 KB |
Oct 2 2012 12:28 AM |
Zimbabwe - Armed Police Stealing Farm Equipment.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:28 AM |
Zimbabwe - Monkey Behind Famine.htm |
HTML File |
3.2 KB |
Oct 2 2012 12:31 AM |
ZionismInAgeOfDictators.pdf |
PDF Document |
1.3 MB |
Oct 2 2012 12:28 AM |
ZionistAntiSemitism.pdf |
PDF Document |
32.7 KB |
Oct 2 2012 12:28 AM |
zionistcoverup.pdf |
PDF Document |
1.4 MB |
Oct 2 2012 12:33 AM |
zionistcoverup.rtf |
RTF File |
1 MB |
Oct 2 2012 12:31 AM |
Zionists Cheer Creep DeLay.htm |
HTML File |
3.7 KB |
Oct 2 2012 12:28 AM |
Zionist Shill's Mistake Endangers Family.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:28 AM |
Zionists Show Contempt For Christians.htm |
HTML File |
3.4 KB |
Oct 2 2012 12:28 AM |
Zionists Slam Greeks.htm |
HTML File |
3.9 KB |
Oct 2 2012 12:30 AM |
Zionists Threaten Leader with Occult Ritual Murder.htm |
HTML File |
8 KB |
Oct 2 2012 12:28 AM |
Zionist Televangelist Paid Hush Money in 'Gay' Scandal.htm |
HTML File |
4.1 KB |
Oct 2 2012 12:30 AM |
Zionist Thug Invaders Stir Plate of Violence for Passover Celebrations, Celebrate the Cruel Killing of Innocent Egyptian Children 3,000 Years Ago..html |
HTML File |
14.4 KB |
Oct 2 2012 12:31 AM |
zogencryption.htm |
HTML File |
21.4 KB |
Oct 2 2012 12:27 AM |
ZweitesBuch.pdf |
PDF Document |
324.9 KB |
Oct 2 2012 12:32 AM |
ZyklonAd-War.pdf |
PDF Document |
313 KB |
Oct 2 2012 12:33 AM |
‘Patriotism’ is the Last Refuge of the Scoundrel.htm |
HTML File |
4.9 KB |
Oct 2 2012 12:32 AM |