Home | About Us | Hotline/KDX | Support | Forums
The preterhuman.net network relies on contributions from its users to maintain services. Advertising and affiliate links on this site do not provide enough income to cover the hosting costs. For donations of hardware and software, please visit this page. For PayPal and Bitcoin/Litecoin donations, please use the buttons above.
Filename Type Size Date Modified
../
'Affirmative Action' Chief Latest 'Victim' of Katrina_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Anti-Semitism' Center Set Up at Yale_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Border Baby' Boom Strains South Texas_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Down Low' Lifestyle Causing AIDS Epidemic Among Blacks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Down Low' Lifestyle Suspected in Porn Industry HIV Scare_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Gay' Groups Fight Parents Over School's Mandatory Homosexual Indoctrination_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Governator' Refuses Tookie Clemency_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'IQ' vs. Standardized Tests_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'I Was a Victim of Racial Violence in Junior High'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Madonna' - Diva of Degeneracy to Perform in Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Mighty Whitey' Defends Algiers Point_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Mud Duck' - Vang Trial Hits Emotional Peak_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Neutral' Official to KLA - 'Careful With Those Grenades'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Sugar daddies' fuelling HIV spread_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Tolerance' Runs Out for Firm_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Voices of Heaven' Ordered Not to Sing Sacred Music_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
2 standards for diversity in the legal fraternity_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
9-11 Families Demand Action on Immigration_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
15,000 Hmong Head for Minnesota_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
50 Cent Gives New Meaning to 'Da Bomb'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
100 Million Dead - JEWS AND COMMUNISM Part 1_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
100 Million Dead - JEWS AND COMMUNISM Part 2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
100 Million Dead - JEWS AND COMMUNISM Part 3_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
260 million CHRISTIAN Lives Lost_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
2005-12-07 - Wanted - More Race Realism, Less Moralistic_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
2005-12-07 - wanted_more_race_realism_less.php_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Abandoned and Betrayed_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Abandoned Gold Standard Guarantees Inflation_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ABC Targets White Children_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Accused Negro Sniper to 'Question' His White Victim_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ACLU Top Heavy with Jews_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Date with Bevin_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ADL's Foxman - New Testament is Anti-Semitic_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ADL Anti-Defamation League of B'nai B'rith conducts smear campaigns - ADL Anti-Defamation League of B'nai B'rith is caught in cover-up of its crimes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ADL Briefs U.S. House on Internet 'Hate'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ADL Demands Gulag for Dissenters_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ADL Führer Warns of 'Intermarriage' and Public Schooling_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ADL Opponents Officially Designated As 'Terrorist Organizations'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Adorno's Bastards and the Frankfurt School_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ads Declare Population Driven Environmental Crisis In California_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Advice on building an electric car for those interested_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Africa In Our Midst - Lessons From Katrina_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
African 'Culture' Spreads HIV_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
After Millennia in India, Lost Tribe Returns to Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Agitprop_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Great Day in L.A._files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Group of Friends - Magnet For A Lonely America_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
AIDS Alert! Avoid Sugar Daddies!_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
AIDS Epidemic Among Black Elite_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
AIPAC Congratulates Itself on the Slaughter in Lebanon_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
AIPAC Espionage Case Dismissal Gambit Fails_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
AIPAC Scandal Breaks Loose_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
AIPAC Warns Dems Not to Appear at Anti-war Demo_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Alabama - Immigrants Make School Rolls Larger than Town_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Alan Stang - 2004-01-16 - 'Martin Luther' King - Communist Fraud_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ali G Worries ADL_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Alleged Racial-Beating Victim Admits Concocting Story_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Look Back at Revisionism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Alpin MacLaren - 2006-01-06 - Cold Turkey - Multiracialism is destroying our schools_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Alpin MacLaren - 2006-02-09 - Civil Wrongs_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Alpin MacLaren - 2006-03-02 - When Logic Fails_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Man Named Arkan_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
America's Middle Class Shrinking in Globalist Economy_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
America's Most Powerful Hate Group_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
America Disappearing_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
America Firster Jew Exposes Israel and the Zionist Network_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Americans Say Enough is Enough! Miller Beer Boycott Update_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Amid Katrina Chaos, Congressman Used National Guard to Visit Home_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Mile Too Far_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Minuteman Boosts Border Overhaul Reform_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Anarcho-Tyranny—Where Multiculturalism Leads_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A National Emergency_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Andrew Young Pulls a 'Mel Gibson'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A New Commission for a New Era_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Anti-Child-Molester Protest Stopped by 'Anti-Fascist Action'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Anti-White Discrimination Plagues European Art Scene_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Once Great Britain_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Apartheid State of Israel Expands Colonization of Golan Heights_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
AP In Hurricane 'Moral Equivalency' Hassle_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
AP Interviews Geert Wilders_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Apocalypse at Dresden - The Worst Massacre in the History of the World_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Apparent Drug Overdose Claims Life of National Vanguard Foe_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A review of La convergence des catastrophes by Guillaume Corvus_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Arm Against 'Katricians,' Gun Dealers Tell Houston_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Artful Anecdotes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Asians Murder British Lad for Being White_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A Split In the Racist Right_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Assassination Attempt on David Duke_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Assault Arrest Followed Word to Cheney_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A theory of Einstein the irrational plagiarist_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
August 23, 1917 - Black Mutiny Leaves 16 Whites Dead_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Australia - Rape Gangs and Multiracialism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Austrian court confirms British historian guilty of Holocaust denial_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Austrians Fed Up With Kosher Arnie_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Autumnal Equinox Comes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A V-Reader Gives Belgians a Message_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Avoid Mestizos - AIDS Rampant Among Mestizos_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A White Future is Coming - an interview with Bob Whitaker_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
A White Majority For New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Axe Wielding Albanian Mob Brutally Assaults Elderly Serb Couple in Kosovo_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Aztecs Butchered, Ate Prisoners_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Background on the Jewish Defense Organization_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Back to...Homeschool_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ban-Crazy Brits Nix St. George Again_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Baton Rouge Whites Mob Gun Stores_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
BBC To Report On London Kabbalah Center_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Beauty, Art, and Race_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Behind the Mask of Respectability - The truth about the Anti-Defamation League of B'nai B'rith_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Belgian Police Raid Revisionists_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Belgium - Multicultural Fascism Now Official Policy_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Beloved Wagnerian Soprano Passes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Benedict Meets with Dissident Journalist_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Benedict to Meet with Traditionalists_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Bergen's Lie_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Between the Jews and the Gentiles -- In the Aggadah, the Kabbalah, and in Jewish Thought_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Beyonce - 'I Make Black Records'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Beyond Chutzpah_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Birmingham Riots - Color is Only Skin Deep_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black 'Jews' Accused in Israeli Welfare Scam_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black Ex-Crack Salesman to Launch 'Books'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black God Begs Devil for Dignified Demise_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black HUD Chief Foresees a 'Whiter' New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black Leaders and the Demise of the OIC_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black Muslim Update - Oakland Store Arab Kidnapped_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Blackness Tells It Like It Be_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black Panther Foundation Seeks to Sell 'Burn Baby Burn' Hot Sauce_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black Panthers Jailed in Cop-Killing Probe_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black Refugee Accused of Raping Retarded Girl_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Blacks on New Orleans Looting Rampage_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black US Employees Accused of Slave-driving in Africa_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Black Vikings Fumble 'Ethics'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Blood on the Frost - Never Forget the Hmong Massacre_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
BNP Gets Voice on Yorkshire Race Council_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
BNP Leader Affirms - Islam 'Wicked' Faith_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Bombs and Hurricanes - Our Struggle_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
books-immigration_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Boycott Miller for Supporting Illegal Aliens and Illegal Immigration_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Brigham Young's Speech on Slavery, blacks and the Priesthood_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Britain Recruited Muslim Terrorists_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Britain’s Racial Diversity Brings Murder; No Justice_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Britons Pay Price for Neo-Con Madness_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Briton tells of Katrina nightmare_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Brooklyn-Based Jew Admits to Trafficking in Women_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Brooklyn - Black 'Students' Charged With Anti-White Race Attack_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Brooklyn Jew Ritually Murders Chickens_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Bush - It's All About the Spin_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Bush Buddy in Flap over Jewish 'Holy Water'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Bush Speech Gave Race Hustlers Fresh Ammo_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
By way of deception thou shalt do war_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
By Way Of Deception_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
California - April Gaede Awarded Queen Isabella Prize_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
California - Minuteman Won Election Day Vote_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
California - Pro-White Music At Folk The System_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
California - Tookie's Son on the Run_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
California - Tookie Executed_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
California Initiative for State Border Police Gaining Ground_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Can 'Liberals' Be Educated_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Cannibalism in the African Congo_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Cans of Paint, Two White Halves, and Chromosomes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Challenging the Power of the Jewish Lobby - What Should Be Done_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Challenging the Power of the Jewish Lobby_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Chavez Condemned for 'Anti-Semitism'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Cherishing an Older Catholicism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Chertoff Aide Guilty in Child Porn Case_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Chertoff Claims He Didn't Have A Clue_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Chertoff Proposes Non-Profit Spying Group_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Chertoff Timeline_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Children - National Treasure or Personal Luxury Item_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
China, Deflation And The Dollar_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
China Replaces U.S. As World's Largest Exporter_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Chosen for Pornography_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Christian Colleges Offer Free Tuition to Katrina Refugees_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Christians in Jerusalem Want Jews to Stop Spitting on Them_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Church asks evacuee to leave_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Church fighting IRS over anti-war sermon won't give up documents_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Churchill's War/ <Directory> <Directory> Oct 4 2015 4:43 PM
Chutzpah - Zionists Running Anti-Slavery Organization_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Civil War in Europe_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Colorado - 57 Refugees Have Felony Records_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
CompleteGuide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Confirmed - Snipers Black_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Congressional Black Caucus Holds Press Conference_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Congressman Apologizes, Denies Assaulting Mistress_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Contemporary Trotskyism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Controlled Media - Forget the Facts About Katrina_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Corrupting Our Police_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Court Temporarily OKs Domestic Spying_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Court to Tookie - No Thanks, Snitch_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Creationism and Truth_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Crime Cover-Up in DC_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Criticism is Not Hate_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Curt Maynard - 2006-07-02 - A Frank Discussion of Jewish Group Dynamics_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Czech Gets Expensive Lesson_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dallas Cops Nix Katrina Officers_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dan Osterton - 2006-07-20 - The Necessity of Invasion_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Daryl Bradford Smith - Prepare for the upcoming battle_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
David Daugherty - 2006-02-09 - Thanks, We Have Our Own Media Now_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
David Irving the 'Anti-Semite'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
David Lane - Dissension in the Ranks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
David_Lane - The Final Address of David Lane to the Jury_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dealing With the Peak Oil Critics_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Death Gate Cycle/ <Directory> <Directory> Oct 4 2015 4:43 PM
Debating the Lobby_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Deejay - 'I'm Coming for Your Seed'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Deejay’s Appeal - ‘Kill the Whiteness Inside’_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Defense Firms Making a Killing on Iraq War_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Defensible Racism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Democrats Condemn Chertoff's Incompetence_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Denver National Vanguard - Supporting the Columbus Day Parade_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Desperate Jewish News Outlets Abandoning Last Pretenses of Honesty_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Devil's Advocate - The Chinese Have Guts_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Did Arabs Accidentally Get Canned Pork By Mistake_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Did Time Magazine Lie to Pad Circulation_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Disaster Buck Stopped at Chertoff, Not Brown_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Discussing Race in a Globalized World_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Diversity Can Only Be Countered With Brutality And War_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dividing the World_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Do Blacks Deserve Billions for Slavery_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Do They Think It’s Worth It_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Do Whites Really Deserve to Exist_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dr. Lorraine Day’s Response to Judy Andreas - zionism -_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
DR Congo's atrocious secret_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dreaming of a Black Christmas_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dream of inter-racial cooperation finally a UK reality_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Drug Feud Claims Life of Anti-White Activist_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dumbing Down America_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dutch Inquisition Reborn_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Dutch to Become First European Nation to Ban Burka_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ebonics Suggested for District_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Editing Martin Luther King, Jr_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Educational Sabotage_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Educators Baffled at Stubborn Achievement Gap_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Edward Fagan Sues Lloyd's of London, U.S. Government_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
einstein-prioritymyth_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
EinsteinStoleE=mc2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Eire - YOU DID IT! Now Let's Build On the Success_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Elizabeth Smith - A Woman Looks at the Lifetime Channel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Empowerment by Rape - the Sexual Holocaust_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ending the Dollar's Tyranny_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
End of an Era - Spearhead to Close_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
End of the Rainbow_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
England Prepares to Honor Millenium of First Patron Saint_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
English Lad 'Too Pale'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Englishman's Zimbabwean Road Trip to Texas_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Enron - A Microcosm of America_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ethiopian Government Begs After Bumper Crop_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Euro 2005 DVD_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
European Origins of Halloween_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Europeans Having Second Thoughts about Turkey_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
European Union Applies 'Hate Speech' Rules to Internet_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Europe’s Successful Moon Probe Mission_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Euro Slurs and Hate Caricatures_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ex-IRA Soldier Condemns Loss of Traditional Ireland_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ex-Security Chief Blows Whistle on UN's Kosovo Mission_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Exercise, It’s Not What Your Doctor Prescribed_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Facts To Consider Concerning The Holocaust_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Fading Illusions - D-Day and Reagan_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Fagan Files $1 Billion 'Holocaust Compensation' Lawsuit_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Failures of Our Age - Capitalism and Communism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Famous people with Scotch Irish blood_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Farewell to a Good European_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Fast Times at Regnef High - crying-wolf_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Fear and Illusion_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Feds Say Katrina Refugee Gangs a Threat_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Fewer Than 50,000 Whites in Zimbabwe_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Fighting Organized Crime_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Final Verdict - The false connection between Tim McVeigh and The Turner Diaries_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Finkelstein Debates Israeli Pol_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Five Myths That Sanction Israel's War Crimes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Florida - 'King Tut' Prompts Black Protests_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Florida - Homeowners Association Says 'No' to Evacuees_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Florida - Vote Ubele_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Florida School Board Rejects Hall's Resignation_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Foreword to the new edition - Zundel's Story_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Forgotten Realms/ <Directory> <Directory> Oct 4 2015 4:43 PM
Former Reps. Earl Hilliard (D-Ala.) and Cynthia McKinney (D-Ga.) - Bad for Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
France - Chirac Calls for Police State to Enforce Multiracialism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
France - Teacher in Hiding_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
France - Turks Must Admit Genocide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
France Lays Dauphin to Rest_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Frank Roman - 2006-10-07 - Impeach The System_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Free Pro-European Music_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Free Speech Can Be Fatal_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Friends of Ulster - USA Scotch Irish _ Ulster Scots_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Front National MP Suspended from Teaching Position for Calling for Open Debate_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Full Text of Ahmadinejad's Letter to Merkel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Genes Trace the Ancient Wanderings of White People_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Genetic Branching - Keep it Going_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
German Politicians Talk Turkey_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Germany - PC Gift to Patriots_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
God, Religion, and Tribal Conflict_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
good_jewbad_jew_paradigm - The Mindset that Impedes Civilization's Healing Process_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Governor Schwarzenegger's Statement Denying Tookie Clemency_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Guilt March Hosts Named For Plagiarist_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Guts - A White Man Who Won't Back Down_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Guy Ritchie - Kabbalah Ruined My Film_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Half of Katrina Refugees Are Criminals_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hans Christian Andersen (1845) - Holger Danske_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Happy German-American Day_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Has King Tut Been 'Whitewashed'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Head of Homeland Security Has Ties With Suspected Financier of 911_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Heather Mac Donald on Immigration on National Review Online - A Latin conservative tidal wave is not coming_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Henry Ford - 1922-01-07 - Candid Address to Jews on the Jewish Problem_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Henry Kissinger - The Walking, Talking Conflict of Interest_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
hey're Not All Bad...Are They_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hezbollah Broke Israeli Codes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
High Druid of Shannara/ <Directory> <Directory> Oct 4 2015 4:43 PM
High School Failure Rate Highest in Non-White Districts_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hilarious PC Language Lesson_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Historical Myth Justifies Golan Heights Occupation_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Historical Revisionism – International and Independent Scientific Historical Research/ <Directory> <Directory> Oct 4 2015 4:43 PM
H Millard - Homeless Jack on Iran, Freedom, Intellectuals, and the Holocaust_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hmong Immigrant Commits Mass Murder in Northern Wisconsin_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hockney's Secret Knowledge - Refuted_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Holger Dansk - Denmark's Mountain King_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hollywood Slanders Italian Americans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Holocaust Fraud_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Holocaust Hoax to be Hammered at Upcoming Conference in Iran_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Holocaust Lawyer Faces $3.2 Million Malpractice Judgment_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Homeland Security's Casualties_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Homeland Security Nominee Chertoff Aided 9-11 Terror Suspect_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Homeless Jack Offers a Primer_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Homeless Jack on New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Home on the Range_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Homosexual Groups Trying to Distance Themselves From Foley_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Honoring Robert E. Lee_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Houston - Turf War Breaks Out between Katrina Refugees, Locals_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
How Many More Nations Will Israel Attack_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
How Many Tanks Did Israel Lose_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
How Muslims Deal With Third World Immigrants_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
How New Orleans Was Lost_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
How Small Genetic Differences Give Racial Divergency_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
How Unskilled Immigrants Hurt Our Economy_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hugo Chavez - Rise Up Against the Empire_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hurricane Katrina - Blacks Worsen Disaster_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hurricane Katrina and Black Behavior_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hurricane Katrina Devastates Duke Headquarters_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Hushed-up Israeli Spy Operations against USA and Mexico 2000 - 2003_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
If You Tolerate This..._files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Igniting the Spark - An Interview With David Duke_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Illegal Immigration - War with Mexico Approaches_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Illegal Immigration and the Racism of 'Antiracism'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Illegal Immigration Sparks Race War in Cities, Prisions_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Illegals Demand the 'Right' to Break the Law_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Illinois Cops - Arabs Beat, Gas Black_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Indian Schools, Genes, Assimilation, and Illegal Aliens_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Indians Reject Black Claims_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Indicted - Republican Corporate Whore DeLay Resigns_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
In Italy, Al Qaeda Turns to Organized Crime for Protection_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
In Praise of Saudi Arabia_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Institute for Political & International Studies_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Interracial Rape Victim - Called by God to 'Minister Against Racism'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Interview with the Grim Reaper - StantonReaper0905_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Introducing the Global I.D. Card_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Iran - The 'Holocaust' Threat to World Peace_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Iranians Produce Holocaust Cartoons_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Iraq - Christians Leery of Islamic 'Tolerance'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Iraq at the Gates of Hell_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Iraqi Resister - Black Soldiers are Targets_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Irish Academics Urge Israel Boycott_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Irreconcilable Differences_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Is any of this stuff made in Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Is Europe Unable to Assimilate Its Growing Islamic Minority_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Islamic Headscarf Ban Debate Hits Australia_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Islamic Wisdom - 'Rapist' Jailed, 'Victim' Executed_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Islamists Throng in Europe's Powder Keg_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Islam versus Christianity – A reply to The Pope!_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Is Neocon Spokesman Soliciting Murder of David Duke_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel's Interior Minister - 'Stop Spitting on Christians'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel's Sex-Slave Industry Soars_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel - Beyond Good and Evil_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel - New Party Urges Expulsion of Non-Jews_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel - Poll Shows 64 Percent of Israeli Jews Favor Ethnic Cleansing_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel - Was BBC's Peter Hounam Arrested as Punishment_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel Honors Jewish Terrorists Who Attacked America_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli-Sponsored Educational Program for NY Schools_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli Gangster Shot Dead in Russia_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli Minister Calls for Nasrallah's Death_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel in Hot Water Over New Zealand Spies_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli Nuclear Whistleblower Vanunu Speaks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli PM's party plagiarizes from Texas Democrats_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
IsraeliPrimeMinisterDeclaresJewWarOnIranAndSyria_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israelis Among the Holocaust Deniers_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli Sexpionage - The McGreevey, Condit and Clinton Affairs_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israelis Launch Voting Guide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli Sniper Assassinates Two Children_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli Spying - The Mother of All Scandals_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israelis Win Contract To Secure US Borders_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli troops seize million dollars in bank raids across West Bank_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israeli Website Exposes Jewish Extremism!_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel Loan Program Limited to Jews_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel Lobby Denial_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel Pushing U.S. to Bomb Iran_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Israel Wants IAEA to Ignore its Nuclear Arsenal, Concentrate on Iran_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Is There Some Bravery Left in Braveheart_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
It's 1984 in Massachusetts – And Big Brother Is Gay_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
It's Coming to America, Too_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
It's the Genes, Stupid!_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
I Was Israel’s Dupe_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jagger Rejects Kabbalah after Extortion Attempt_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
James and Cindy; Progress and Hope_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Janis Ian - 2002-09-16 - THE INTERNET DEBACLE – AN ALTERNATIVE VIEW_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
JB Cash - 2006-01-05 - Death of a Hero_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
J Dub Gettin’ Funky in Durham_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jeff A. Taylor - 2006-07-24 - Rah-Rah IDF_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jerry Falwell Now Supports 'Gay' Rights_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
jew-occupiedgovernments-USSR-moreevidence - Historical Sources_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
jew-organizations-JDL-Zionist-Terror-Network-IHR_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish 'Muslim' Threatens West with Genocide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Academic Blasts Middle-class Whites for Not 'Integrating' Kids_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Anti-Gentile Hatred in Porn Industry_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Censors Seek to Ban Dissident White Historian_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Genetic Diseases 2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Genetic Diseases_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Lawyer Edward Fagan to Sue African Marxists_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Leader Calls On Zionists To Kill All Palestinian Males_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Mafia Expands White Slave Trade to London_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Porn King May Have Skipped to Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish rabbi calls for extermination of all Palestinian males_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Support for Open Borders - Is it Biological_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Supremacist Michael Chertoff Named Head of Homeland Security_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Supremacists Shaping Election of UN Secretary General_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Terrorist Gets Prison_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Usury and Finance Capital_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Voters Object to New Polling Place2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish Voters Object to New Polling Place_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jewish WMD Whistleblower Vanunu Released But Not Free_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jews - A Religious Community, a People, or a Race_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
jews beat Santa Clause_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jews Relentless In Pursuit of Internet Censorship_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jew Threatens LA With New 9-11_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
JewWatch/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jingle Jam Chaos Closes Minnesota Mall_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
John Barleycorn_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution, continued_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
John H. Campbell - The Moral Imperative of Our Future Evolution_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
John Tyndall - An Anagogical View of Empire_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Journalist Held In Dungeon Of Filth_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Judea declares war on Germany_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Judeo-Fascism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Jury Selection to Be Moved in Bloodbath Trial_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kaballah Crazy!_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kabbalah Red String Market Threatened_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kathleen Christiso - 2006-09-12 - The Coming Collapse of Zionism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina, Iraq, and the Know-It-All Syndrome_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina - Neo-con Pals Rake in the Dough_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina and the Black Tsunami_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Black Tells Fox You Owe Him_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Evacuee Charged with Child Murder_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Evacuees Binge on Cape Cod_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Students Spark Constitutional Debate_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Tensions - School Official Resigns over Remarks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Threatens Croatian-American Tradition_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Threatens to Swamp Utah_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Unleashes HIV+ Horde_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Katrina Victims Unwelcome in Some Towns_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kenya - Black Priest Kills White Roman Catholic Bishop_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kill Arabs, Cry Anti-Semitism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Killer Plays Race Card_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kill the Christians_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kirkby TV Covers Reconquista_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kook Conspiracy Theories - Reject Them_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Kosovo - A Dangerous Cosmetic Salon_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Lamb Gaede - 11-year-old White Girl Stands for Truth in California_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Lambing Flat_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Land Of Dope And Jewry_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
La Pauvre Petite - Schoolgirl abduction-murder rivets France_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Lapdance King, Lawyer Indicted in 'Mafia' Probe_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
La Raza List of Corporate Traitors_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Law Enforcement Embattled in New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Leftist Violence Flares at Norwegian Election Event_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Letter - A Father Pleads for His Son's Future_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Letter from Atlanta - The Seamy Gold Club Trial_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Liberating America From Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Lisa Rad - 2006-02-15 - Fall of the Fourth Reich_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
list-of-jews_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
London - Jewish Mafia Loses Three Soldiers_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
London Mayor Challenges Suspension_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Louisiana - Town's First Black Police Chief Charged in Crack Probe_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Louisiana National Guard Troops Watch Katrina from Iraq_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Louisiana Senator Threatens To Assault Bush_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Low-paid illegal work force has little impact on prices - 2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Low-paid illegal work force has little impact on prices_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
M. P. Shiel - 2006-03-07 - Equality, Democracy, and their Killing Fields_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Madonna Listed Among America's 'Most Powerful Jews'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mali - Africans Still Practice Human Sacrifice_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Marcus Epstein and Michelle Malkin_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Marian Evans -- Catastrophe in Kansas City_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mariel Deja Vu_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mark Weber - 2006-02-10 - Holocaust Survivor Memoir Exposed as Fraud_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mark Weber - 2006-03-16 - The Jewish Role in the Bolshevik Revolution and Russia's Early Soviet Regime_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Marshals - Innocent People Placed On 'Watch List' To Meet Quota_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Marxists Gamble on Geeks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
MaryPhaghanSong_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mass Grave Containing Kosovo Serbs Found_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mass Grave of Massacred Poles Found in Ukraine_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Matthew Downing - 2006-03-24 - Massachusetts - Pro-White Outreach Frustrates Local Media, ADL_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Matthew Hale - Justice Denied_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
mcveigh_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Media Note - 'Michael Savage' Lashes Out Against Nick Berg and His Family_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Medicating heretics_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mel Gibson's Anti-Zionist Priest Dies_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mel Gibson Denounces Jews' War_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Memo Proves Brown Paid for Chertoff's Incompetence_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Merry Christmas -- and on to Victory!_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mestizo Gangs Control the Suburbs_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mestizos too violent for open debate, crowd control impossible_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mexico Conquers Texas_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mexico Ups the Ante in Conflict with American Blacks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Michael Chertoff - 'Trust Us'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Middle Class Families in Worse Shape Than Ever, Study Finds_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Minnesota Shocker - Black Muslim Wins Primary_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Miscegenator Murders White 'Girlfriend' and Unborn Child_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mission Fights Eastern European Sex Slave Traffic_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mistrial for Accused Jewish Mafia Godfather_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mom Gives Kids Dose O’ Diversity_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
More 'Racist' AIDS Statistics_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
More Illegal Aliens Accused in Gang Rapes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
More Jewish Mobsters Arriving_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
More Legal Atrocities Against Serbian Whites_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
More on the Cabbala_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
More on the Orlando Sentinel's Campaign Against Free Speech and Thought_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mothers in Houston Join Katrina Altercation_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
MuadDib's Primer on the Jews_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Multicultural Jihad Wrecks Dutch Racial Harmony_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Multiracial Children Have More Psychological Problems_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Multiracialism and Conservatism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Museum Pulls 'Offensive' Artwork_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Muslim 'Tolerance' Boils Over in Egypt_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Muslims Back Down In Face of White 'Threat'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
My Big Biofuels Bet_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
MY FAREWELL TO ISRAEL_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Mystery of the mummies_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Myths, Misunderstandings, and Outright Lies - gold-confiscation-1933_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
N.O. Cops Suspected of Stealing Up to 200 Cars_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Namibia - Tribe Demands German Reparations_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
National Alliance Speaks at Campus Mideast Forum_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
National Vanguard - Just Say No to Illegal Immigrants_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
National Vanguard Activist Wins Victory Against Censorship_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Negro Accused of Spreading AIDS_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Nerds Join Neo-Cons to Oppose National Vanguard_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Netherlands - Jihadi Plot Upsets Liberals_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Netherlands Braces for 'Jihad'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Africa_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Book Helps White Families Become Prosperous_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Charges for Lightfingers Tom_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New From FEMA - The Looter Relocation Program_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Jersey - Jews Refuse to Vote in Churches_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Jersey Girl Murdered and Dismembered By Mestizos_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Jersey Icebergs and Whores_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Jersey Rabbi Says Katrina Refugees Welcome in Utah_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans - Cops Join in Looting_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans - Second Amendment Suspended_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans - The Rise of 'Mighty Whitey'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans Africa-Like Well Before Hurricane Katrina_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans and 'The Gods of the Copybook Headings'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans Chaos Reveals America on the Brink_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans Corrupt 'Down to the Bone,' Former Pol Charges_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans Descends into Africa-like Savagery_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans Parody Challenges System Media_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Orleans Pays For Affirmative Action_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Report Sheds Light on Hispanics in U.S._files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Sex Scandal Rocks Holy See_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Newspaper Calls Mass-Murder 'Sad' Flier Distribution 'Despicable'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Newsweek - Superlobbyist is Crooked_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New V-TV Video - Katrina Relief_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New Yorkers to study about Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
New York Times - Chertoff Approved Abu Ghraib Interrogation Methods_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Nick Griffin - The Race Murders the Media Ignore_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ninety_five_theses_on_the_holoca - Ninety Five Theses on the Holocaust_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
NJ - Mestizo Cop Helped Drug Ring Say Officials_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
NJ - New Black Panthers Come to Town_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
NJ Ethics Office - Fagan Stole $400,000_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
No, We're Not 'All Israelis Now'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
No Black Day in Jesse's Hometown_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
No Debit Cards for White People_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
noose_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Norman Language Flourishes in the Channel Islands_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
North American Students Trained for 'Merger'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Norway - 19,000 'Asylum' Seekers Evade Authorities_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Norwegian Patriots Demolish Sell-outs_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Norwegians Discover Joys of Islam_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Norwegian Teens Cool to 'Diversity'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Nutty Professor Charged In Hate Crime Hoax_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
NY Times Hit Hard as Controlled Media Take Continued Beating_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Oakland - Black-Yemeni Tension Ratcheted Up_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Oakland - Black Muslim Tensions Heightened_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Oakland - Blacks Loot Burned-Out Shell of Arab Store_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Oakland - Video Beating Victim Comes Forward_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Oakland Beating Video - Cops Baffled_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Oakland Update - Blacks Charged With Hate Crimes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
October 7, 1571 - The Deliverance of Europe at Lepanto_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Of Course There Is an Israel Lobby_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ohio - War Protest Turns Violent_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ohn Lennon's 'Imagine' (revised)_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Once We See Black We NEVER Go Back_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
One Percent of Population Commits Half of Homicides_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
On White Genocide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Over 75,000 AIDS Cases in New York City_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Patric Ewing testifies he twice had oral sex at Gold Club_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Pay No Attention to the Jews Behind the Curtain—the Iron Curtain_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
PC Desecration of Spanish Holy Site_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Peterloo Massacre_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Petty Criminal Leaves Sarkozy Red-Faced_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Poignant Photo Strikes Reader_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Poland Abruptly Cancels a Speech By Critic of the Jewish State_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Police - Hurricane Evacuees Kill Woman who Helped Them_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Police Demand Resignation of Black Commissioner_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Police Looting - Racial Realities Exposed in New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Police Ordered to Stop Looters_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Polish-Americans Celebrate Harvest Festival_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Polish Father of US Cavalry Laid to Rest_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Political Correctness - The Scourge of Our Times_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Political Prisoners - In America_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Poll Shows Rising Tide of anti-Semitism on Eve of Holocaust Day_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Polls Show Opposition to Iraq War at All-Time High_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Powerful Gains For Pro-Whites in Norwegian Elections_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Pre-Traumatic Stress Disorder-A Glimpse Into Israeli Collective Psychosis_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
President Putin - 'Orthodox Christianity an Integral Part of Russian Culture'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Pressure on Chertoff Builds_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Principal Negative Stereotypes Against European Americans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
printer.php_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Pro-Zionist Televangelist Advocates Murder_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Pro and Con - NFL Star Allegedly Runs Over Teens in Stolen Car_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Progress Party Gets It Right_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Prophecy of the Seeress_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Protestants and Catholics Unite -- For a Brown Ireland_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Protests Loom in Far West, Washington_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Prussian Blue and the First Amendment_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Purchasing Precious Metals_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Putin's Cannibals 'Gaffe'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Putin, the Patriot_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Putin - Those Who Bombed Serbia Should Pay Damages_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Putin Pilgrimage Strengthens Greco-Russian Links_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Questions of Preferential Treatment Raised in Sex Case_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Questions That May Not Be Asked About New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Rabbis to Israeli Military - Kill More Non-Jews_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Race-based Medicine Confirms Genetic Differences_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Race and Murder_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Race Baiting as New Orleans Sinks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Race in Ancient Egypt_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Racial Battle-Lines Divide School_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Racial Explosion 60 Years On_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Racialism versus Communitarianism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Racial Media Jump on Katrina News_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Racial Reality and the New Orleans Nightmare_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Racial Test Gap Remains Large in California_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Radical White Intellectual Predicts World-Altering Tempest_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Radio Station Urges 'Kill Tookie' Emails to Schwarzenegger_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ramadan Madness Looms_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Rap King Shot in Florida_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Reading, Writing and Race_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Real Racial Supremacism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Recent Events Show America is Changing_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Refugee Numbers On the Rise_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Religious Group Flagellate Selves Over 'Reparations'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Remember the Turkish Genocide of the Pontic Greeks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Report - Cannibalism in New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Report Illegal Aliens - status_report_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Republicans Back Pro-Homosexual 'Hate Crimes' Expansion_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Resisting Defamation - Principal Negative Stereotypes Against European Americans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Resisting Defamatory Anti-White Language_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Restoring The Small Farm_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
RESULTS OF MINNESOTA TRANSRACIAL ADOPTION STUDY_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Rhode Island - Cops Catch Illegals at Dem Chair's House_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Rockers Demand Recognition of Armenian Genocide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Rosa Brooks - Criticize Israel - You're an Anti-Semite_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Rural Traditions of the Pennsylvania Dutch Still Strong_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Russia - Sophisticated Sex Slave Operation Uncovered_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Russian State Duma Denounces Armenian Genocide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Russian Wealth in Hands of Jews - One Hundred Own Quarter of Wealth as Russians Starve_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Russia Ponders Tax on Childlessness_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
School Officials Look the Other Way When Whites are Abused_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Science Strikes Back_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Scotland - Poseurs Headed for Kneecapping_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Scotland - Race Killing Case Opens_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Seattle Test Scores Anguish_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Sex Offenders Slip Radar_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Sex Rabbi - 'I'll Debate David Duke'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Sharon - The Al Sharpton of the Middle East_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
shelby - Terrorism In South Africa_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Shmuley loses it_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Silver - Why You Should Own It_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Singapore Bloggers Latest Victims of Multicultural Intolerance_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Sinn Fein Touts for Third World Ireland at Westminster_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Sir Gawain and the Green Knight - Indo-European Archetypal Myth_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Slave Account - Fiction_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
So Long Tookie_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Some Comments on 'Racism'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Soros 'An Extremely Evil Person'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
So You Think You're a White Anti-Racist_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
So You Thought the Mob Was Run by Italians_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Specific Sites Excluded from Google.fr and or Google.de_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Spelling Used TV to Push Homosexual Agenda_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Spoof - Byzantine Emperor Apologizes to Muslims For Quote_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
St. George and the Harridan_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
St. Petersburg, FL - ethnic_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Stab in the Back - Israel’s Attack on the USS Liberty_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Stanford - Racial Groupings Match Genetic Profiles_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Steve E Romer - 2006-04-18 - Make Illegal Aliens Felons - That's Not Enough_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Steven E Romer - 2006-02-14 - Tiny Differences, Through Time, are Everything_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Stopping the Unstoppable_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Stop White Genocide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Strangers Among Us_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Strong Showing for BNP_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Subverting the Disney Legacy - Michael Eisner_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Supermob - Sidney Korshak and His Criminal Associates_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Support Freedom of Speech - Wear the Wristband_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Surrounded by Jews, Bush Blasts Mahathir, Says He's 'Wrong' About Jewish Power_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Survey - Israel is Number One Threat to World Peace_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Suspect - My Job Is 'Taking White People's Cars'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Swedes Arrest Alleged 'Anti-Fascist' Terrorist_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Swedes Embrace Inquisition_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Swiss Banks and the Jews - What Happened to the Extra Billion_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Synagogue Desecration Shocks London_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Syrians Snuff Islamist Attack on US_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Take Me to Your Moron_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tampa - When Whites Gather_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tampa Summer Solstice Festival_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Television Pioneer Elma Farnsworth Dies at 98_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Texas Papers Play Up 'Racial' Quotes by Candidate Friedman_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
thadanderson-American_Revolution_Docs/ <Directory> <Directory> Oct 4 2015 4:43 PM
thadanderson-Civil_War_Docs/ <Directory> <Directory> Oct 4 2015 4:43 PM
thadanderson-WWII_Docs/ <Directory> <Directory> Oct 4 2015 4:43 PM
That Which is Good, Shall be Called Evil_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The 'Holocaust' Is A Typical Zionist Myth_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The ADL, Jesus, and Anti-Semitism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The American Nation Part II_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The American Nation_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Anthrax Murders - The Israeli Connection, part 1_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Anthrax Murders - The Israeli Connection, part 2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
THE ARYANS, OR NOBLES_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Barack Obama Myth_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The BBC's One Way Racism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Beast as Saint - The Truth About 'Martin Luther King'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Biological Puzzle of Jewish Behavior_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Changing Face of AIDS_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
THE CHINK IN OUR ARMOR_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Christ-Killers Today_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Color Of Crime And The New Orleans Nightmare_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Confederate Defeat, The Fall Of New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Congo's Atrocious Secret_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dark Side of the Anti-Defamation League, part 1_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dark Side of the Anti-Defamation League, part 2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dark Side of the Anti-Defamation League, part 3_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dark Side of the Anti-Defamation League, part 4_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dark Side of the Anti-Defamation League, part 5_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dark Side of the Anti-Defamation League, part 6_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dark Side of the Anti-Defamation League, part 7_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dark Side of the Anti-Defamation League, part 8_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The De-Zionization of the American Mind_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Deadly Twins_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Destruction of White Youth_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dog Gone Asians_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Drunken Truth_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Dutch Say 'Nee!'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Eternal Value of Privacy_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Factory Farms of Jewish Publishing_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The FCC Scandal_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Forbidden Srebrenica Report - Something The Neo-cons Don't Want You To See_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Fraud of Neoconservative 'Anti-Communism'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Gateway_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Governors Declare An Emergency - Who Cares If They’re Sincere_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Hard Edge of Hatred_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Hidden History of 9-11-2001_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Hollywood Big Lie_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Holocaust Controversy - The Case For Open Debate_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Holy Man and the Ho_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Jewish Declaration of War_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
THE JEWS AND THE CONCENTRATION CAMPS - A FACTUAL APPRAISAL BY THE RED_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Jew Who Fled Rio_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Judas Goats_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Kwanzaa Hoax_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Last Straw - Jewish Death Squads in America_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Leo Frank case_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Liberty Tree_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Love of Ages_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Middle East Initiative_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Missiles at Ground Zero_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Most Corrupt Member of Congress_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Neo-Genocidists_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The New Minority_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Next Victims of Islamic Terror_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Officially Sanctioned Invasion of Greece_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Origins of the White Man - Part II_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Origins of the White Man - Part I_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Origins of the Word 'Racism'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Pope Must Die_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Price White Americans Pay - Never Forget the Hmong Massacre_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Racial Ideology of Empire_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Rednecks Did It!_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
There is No Freedom Without Free Speech_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Rise of the BNP_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Self-Evident Lessons of Madrid_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Shame of Being an American_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Shocking Story of Approved Killing in Mississippi_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Struggle for Caucasia_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Symbiants_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Tapes the Hague Tribunal Hasn't Shown - Muslim Terrorists Massacring Serbs_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Truth About Slavery_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The United States of Barbarism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Weird Wild World of the Zionist Right_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Weird World of Kwanzaa and Other African Hoaxes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Whitewashing of Ariel Sharon_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Winds of Change_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The World is His China Shop and His Shills Make Excuses_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The Wrath of Ka_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
They Want Our Kids_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
The_Jews_in_England_part2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
thinking_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
This Will Come Back to Haunt Us_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Thomas Carlyle and Edward Bulwer-Lytton - Giants of the North_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Thousands Protest Violence in Darfur_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Threats to a Free Internet_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
ThunderDome_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tiny Differences, Through Time, are Everything_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Today Show - Let 'Em Eat Cake_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tonight - Current Issues TV to Host Dr. David Duke_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Toni Morrison - She Simply Can't Write_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tookie's 'Peaceful' Pals Threaten Violence_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tookie Advocate - 'That’s a racist question!'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tookie Finally Ready to Snitch_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Too White, Too Strong_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Top Rabbi - Katrina is God's Punishment for Not Supporting Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tourists Evacuated from Superdome_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Tourists Targeted in New Orleans as Unrest Spreads to Baton Rouge_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Troops Back From Iraq Find Another War Zone_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Troops Find Grisly Scenes in New Orleans Convention Center_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast2_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Turkey, EU Reach Deal for Opening Talks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Turkey Has No Friends; Good for Europe_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Turkish Novelist Faces Jail for ‘Hate Speech’_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Turks Award Zionists with Weapons Contract_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Turks Convict Armenian Journalist of 'Speech Crime'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Turks May Save Drowning Rat_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Two More 'Sexual Indoctrination' Bills Vetoed_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
U.S. Population Nears 300 Million_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
U.S.S. Liberty Crew Reunites_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
U.S. State Department - Israel Plagued by Trafficking_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ugly Lessons from Katrina_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Al Qaeda 'Cleric' Worked for Both Sides_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Birmingham Riots Result of Multicultural Experiment_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Black Gets Prison for al-Qaeda Plot_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - BNP Music Label Launched_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - BNP Picking Up Votes - Viewed as Persecuted Underdog_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - British National Party Chairman Nick Griffin Released_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Censorship by Multiracialists Raises Ugly Head_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Conservatives Fear Nationalist Competition_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - English Town Continues to Suffer From Multiracialism_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Keighley Protest Still On_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Muslims Scream About Ice Cream_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - National Demonstration Against Police Anti-White Racism Planned_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Nov. 2 Free Speech Demo Plan Forges Ahead_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Now It's Griffin_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Police Arrest Anti-White Goon_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Police Investigating Multiracialist Entertainer for Threatening Whites_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Popular Muslim Video Supports Violence Against Non-Believers_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Race Rioting Erupts in Birmingham_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Racial Justice Sunday Staged by Rapidly Shrinking Church_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Secret Police Seize Nationalist Paper_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Top Cop Urges Police To Wear Islamic Battle Colors_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - White Leaders Undaunted by Coordinated Violent Attacks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Whites Furious Over Removal of Memorial To Slain Teenager_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK - Whites Quitting Cities_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK = Church Anger at Islamic Texts_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK Cops Threaten Vet Over Flag_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UK journalist arrested in Israel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ukraine - David Duke Earns Doctorate in History_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ulster - Anti-White Loyalist Thug Slain_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ulster - Loyalists Join Jews in Human Smuggling Ring_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ulster - Religious Fanatics Say No To Catholics, Yes To Non-Whites_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ulster-Scots Culture Enjoys a Renaissance_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
UN Antislavery Day Celebrates Massacre of Whites_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Updated - Who Rules America_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
US - White Poverty Soars_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
US Evangelicals Increasingly Question Pro-Zionist Heresy_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
US Iraq Atrocities Nothing New_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
US Left - Tools of Oligarchs, Zionists, System_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
US Nationalists Record Song for BNP_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
US Provided KLA With Food_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
USS LIBERTY Memorial - AMERICAN LEADERS SUPPORT USS Liberty SURVIVORS_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
USS Liberty Veterans Present Pentagon With Report on Israeli War Crimes_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Usury Perfected_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Utahns Leaving Multiracial Public Schools_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
V-News.org Exclusive - The Plan De San Diego_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Vang Guilty in Hunter Massacre Trial_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Vang Says Three Hunters Deserved to Die_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Vanguard News Network » Blog Archive » Important Thoughts, Financial and Economic Advice_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Vanunu - Israel's Nuclear Arsenal a Threat to Middle East_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Venezuelan Chavez wants to be world's anti-U.S. voice_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Veteran Congressman Paul Findley Exposes Israel’s Lobby_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Vigilantes Attack Elderly Border Protestors_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Viroqua, WI School Board Bans 'Diversity Day'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Voice For Europe - Pan-European Co-ordination Against Turkish EU Membership_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Voices from the Past - Languages of Our Ancestors_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Voodoo Faithful on Annual Pilgrimage_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Voting for Pro-White Parties Is 'Spitting in God's Face'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Wal-Mart Turns in Student’s Anti-Bush Photo, Secret Service Investigates Him_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Waldorf MW I Manuals/ <Directory> <Directory> Oct 4 2015 4:43 PM
Wales - Win for 'Heretic'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
War Criminal at Bay_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
War Party Atrocity Porn_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
War Signals_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Was Columbus Greek_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
WAS THERE REALLY A HOLOCAUST_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Was WWII Worth It_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Watts Riots 40 Years On_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
We at The Scriptorium_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Welcome, TAA#3 readers - Background on our authors subjects_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Welcome News - Turks May 'Shun' EU Talks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Welcome to the Jungle - Superdome Tales_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Wendy Campbell - 2006-09-11 - Parallels between Nazism, Zionists striking_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
We The People_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What's in the New Orleans Water_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What's This About 'Peak Oil'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What's Your Diversity Quotient_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What About 'Affirmative Action' for US Media Ownership_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What Does Israel Want_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What is National Vanguard_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What is So Wrong With White People_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What Makes Palestinians Think They Can_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What Makes Western Culture Unique_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What will become of the ‘American Dream’_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
What Would War Look Like_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Wheat and Chaff_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
When Al Qaeda Was An Ally of 'the West'_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Which Way, Milwaukee_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White America starts winning_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White Children Experience Slavery at Summer Camp_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White Heritage Sites Threatened on Cyprus_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White India_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White Interests_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White People's Party Forms in Nevada_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White Science, Black Humor_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White Slavery Focus of New Book_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Whites Make Stand at Superdome_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Whites Organize in Namibia_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Whites Repulse Turks in Georgian Waters_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Whites Suffering in New Orleans_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White Teen Dragged from Bus, Beaten, and Robbed by Anti-White Gang Members_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
White Wire Newsblog » A History of Kwanza by Ann Coulter…and a Special Kwanza Jingle From the White Wire Staff_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Who Rules America_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Who We Sold the Serbs To_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Why Hitler Attacked Soviet Russia When He Did_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Why Islam Didn't Conquer the World_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Why Israel’s Campaign in Lebanon is Failing_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Why Scandinavia Tops U.N. Standard of Living Index_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
wiesenthal - fake holocaust_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Wisconsin - New Flood of Hmong Refugees Will Strain Already Tight Budgets_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Wisconsin - Rampage Killer, Friends Now Suspects in 2001 Homicide_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Witnesses - New Orleans Cops are Looters_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Worldwide Lack of Concern Over Israel's White Slave Trade_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
www.iraqthejewswar.com/ <Directory> <Directory> Oct 4 2015 4:43 PM
Ygg/ <Directory> <Directory> Oct 4 2015 4:43 PM
YGGDRASIL - Lesson Number One_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Youth Gang Rape Reported in Milwaukee_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Zimbabwe - Armed Police Stealing Farm Equipment_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Zimbabwe - Monkey Behind Famine_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Zionists Cheer Creep DeLay_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Zionist Shill's Mistake Endangers Family_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Zionists Show Contempt For Christians_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Zionists Slam Greeks_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Zionists Threaten Leader with Occult Ritual Murder_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
Zionist Televangelist Paid Hush Money in 'Gay' Scandal_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
zogencryption_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
‘Patriotism’ is the Last Refuge of the Scoundrel_files/ <Directory> <Directory> Oct 4 2015 4:43 PM
'Affirmative Action' Chief Latest 'Victim' of Katrina.htm HTML File 3 KB Oct 1 2012 3:31 PM
'Anti-Semitism' Center Set Up at Yale.htm HTML File 4.5 KB Oct 1 2012 3:30 PM
'Border Baby' Boom Strains South Texas.htm HTML File 4.6 KB Oct 1 2012 3:28 PM
'Down Low' Lifestyle Causing AIDS Epidemic Among Blacks.htm HTML File 6.6 KB Oct 1 2012 3:33 PM
'Down Low' Lifestyle Suspected in Porn Industry HIV Scare.htm HTML File 3.5 KB Oct 1 2012 3:33 PM
'Feldman' Attack on 'Passion' is a Hoax.htm HTML File 5.1 KB Oct 1 2012 3:27 PM
'Gay' Groups Fight Parents Over School's Mandatory Homosexual Indoctrination.htm HTML File 4.5 KB Oct 1 2012 3:29 PM
'Governator' Refuses Tookie Clemency.htm HTML File 24.1 KB Oct 1 2012 3:32 PM
'Hate crime' victims - Young, poor, white - 2006-02-22.txt Text File 4.3 KB Oct 1 2012 3:28 PM
'IQ' vs. Standardized Tests.htm HTML File 149.1 KB Oct 1 2012 3:27 PM
'I Was a Victim of Racial Violence in Junior High'.htm HTML File 7 KB Oct 1 2012 3:30 PM
'Madonna' - Diva of Degeneracy to Perform in Israel.htm HTML File 2.6 KB Oct 1 2012 3:31 PM
'Mighty Whitey' Defends Algiers Point.htm HTML File 4 KB Oct 1 2012 3:30 PM
'Mud Duck' - Vang Trial Hits Emotional Peak.htm HTML File 4.5 KB Oct 1 2012 3:30 PM
'Neutral' Official to KLA - 'Careful With Those Grenades'.htm HTML File 2.8 KB Oct 1 2012 3:34 PM
'Sugar daddies' fuelling HIV spread.htm HTML File 4.3 KB Oct 1 2012 3:32 PM
'The Jews are being pulled from their palaces, decapitated, and fed to the dogs'.htm HTML File 6.8 KB Oct 1 2012 3:33 PM
'Tolerance' Runs Out for Firm.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
'Voices of Heaven' Ordered Not to Sing Sacred Music.htm HTML File 2.6 KB Oct 1 2012 3:33 PM
0,,31580,00.html HTML File 1.2 KB Oct 1 2012 3:28 PM
2 standards for diversity in the legal fraternity.htm HTML File 5 KB Oct 1 2012 3:28 PM
2_On_Being_White.PDF PDF Document 275.9 KB Oct 1 2012 3:31 PM
6millionmyth.pdf PDF Document 181.8 KB Oct 1 2012 3:28 PM
6millionmyth.rtf RTF File 214.9 KB Oct 1 2012 3:28 PM
9-11 Families Demand Action on Immigration.htm HTML File 3 KB Oct 1 2012 3:30 PM
13tribe.pdf PDF Document 445.6 KB Oct 1 2012 3:32 PM
13tribe.rtf RTF File 1.8 MB Oct 1 2012 3:28 PM
15,000 Hmong Head for Minnesota.htm HTML File 2.8 KB Oct 1 2012 3:31 PM
16.3allen.pdf.htm HTML File 8.2 KB Oct 1 2012 3:28 PM
16CrucifiedSaviors.pdf PDF Document 1.5 MB Oct 1 2012 3:31 PM
36-ferrocement-water-tanks.pdf PDF Document 203.2 KB Oct 1 2012 3:34 PM
50 Cent Gives New Meaning to 'Da Bomb'.htm HTML File 2.9 KB Oct 1 2012 3:32 PM
53-francis.pdf PDF Document 177.4 KB Oct 1 2012 3:34 PM
53-km-slezkine.pdf PDF Document 273 KB Oct 1 2012 3:34 PM
53-wch-script.pdf PDF Document 265.2 KB Oct 1 2012 3:32 PM
66QnA.pdf PDF Document 48 KB Oct 1 2012 3:32 PM
72.3bentley.pdf.htm HTML File 7.1 KB Oct 1 2012 3:28 PM
80 BC - The White World’s Oldest Computer.htm HTML File 4.5 KB Oct 1 2012 3:33 PM
88Precepts.pdf PDF Document 20.5 KB Oct 1 2012 3:31 PM
88Precepts.rtf RTF File 36.6 KB Oct 1 2012 3:31 PM
90December.pdf PDF Document 420.7 KB Oct 1 2012 3:30 PM
90November.pdf PDF Document 306 KB Oct 1 2012 3:30 PM
91April.pdf PDF Document 485.3 KB Oct 1 2012 3:30 PM
91February.pdf PDF Document 334.1 KB Oct 1 2012 3:31 PM
91January.pdf PDF Document 345.9 KB Oct 1 2012 3:27 PM
91July.pdf PDF Document 416.7 KB Oct 1 2012 3:29 PM
91March.pdf PDF Document 358.9 KB Oct 1 2012 3:30 PM
94June.pdf PDF Document 587.9 KB Oct 1 2012 3:28 PM
95February.pdf PDF Document 450 KB Oct 1 2012 3:30 PM
95March.pdf PDF Document 515.1 KB Oct 1 2012 3:30 PM
96August.pdf PDF Document 632.8 KB Oct 1 2012 3:31 PM
96December.pdf PDF Document 514.2 KB Oct 1 2012 3:31 PM
96January.pdf PDF Document 441.5 KB Oct 1 2012 3:31 PM
96July.pdf PDF Document 629.8 KB Oct 1 2012 3:30 PM
96June.pdf PDF Document 554.3 KB Oct 1 2012 3:30 PM
96November.pdf PDF Document 487.2 KB Oct 1 2012 3:33 PM
96October.pdf PDF Document 746.1 KB Oct 1 2012 3:33 PM
96September.pdf PDF Document 494.2 KB Oct 1 2012 3:31 PM
97April.pdf PDF Document 455 KB Oct 1 2012 3:31 PM
97December.pdf PDF Document 495.1 KB Oct 1 2012 3:33 PM
97February.pdf PDF Document 440.6 KB Oct 1 2012 3:33 PM
97January.pdf PDF Document 462.3 KB Oct 1 2012 3:28 PM
97Jul-Aug.pdf PDF Document 980.7 KB Oct 1 2012 3:33 PM
97June.pdf PDF Document 458.2 KB Oct 1 2012 3:31 PM
97March.pdf PDF Document 477.8 KB Oct 1 2012 3:28 PM
97May.pdf PDF Document 585 KB Oct 1 2012 3:32 PM
97November.pdf PDF Document 557.5 KB Oct 1 2012 3:31 PM
97October.pdf PDF Document 493.6 KB Oct 1 2012 3:32 PM
97September(1).pdf PDF Document 501.5 KB Oct 1 2012 3:32 PM
97September.pdf PDF Document 501.5 KB Oct 1 2012 3:28 PM
98April.pdf PDF Document 558 KB Oct 1 2012 3:28 PM
98August.pdf PDF Document 541.6 KB Oct 1 2012 3:32 PM
98December.pdf PDF Document 845.4 KB Oct 1 2012 3:34 PM
98February.pdf PDF Document 641.5 KB Oct 1 2012 3:27 PM
98January.pdf PDF Document 488.9 KB Oct 1 2012 3:29 PM
98July.pdf PDF Document 548.3 KB Oct 1 2012 3:27 PM
98June.pdf PDF Document 337.8 KB Oct 1 2012 3:31 PM
98March(1).pdf PDF Document 513.6 KB Oct 1 2012 3:32 PM
98March.pdf PDF Document 513.6 KB Oct 1 2012 3:29 PM
98May.pdf PDF Document 426 KB Oct 1 2012 3:32 PM
98November.pdf PDF Document 1.2 MB Oct 1 2012 3:31 PM
98October.pdf PDF Document 687.2 KB Oct 1 2012 3:28 PM
98September.pdf PDF Document 619.8 KB Oct 1 2012 3:31 PM
99April.pdf PDF Document 316.4 KB Oct 1 2012 3:32 PM
99August.pdf PDF Document 262.1 KB Oct 1 2012 3:27 PM
99December.pdf PDF Document 415 KB Oct 1 2012 3:28 PM
99February.pdf PDF Document 295.6 KB Oct 1 2012 3:33 PM
99January.pdf PDF Document 360.8 KB Oct 1 2012 3:31 PM
99July.pdf PDF Document 320.6 KB Oct 1 2012 3:29 PM
99June.pdf PDF Document 284.5 KB Oct 1 2012 3:31 PM
99March.pdf PDF Document 282.8 KB Oct 1 2012 3:33 PM
99May.pdf PDF Document 270.1 KB Oct 1 2012 3:32 PM
99November.pdf PDF Document 329.7 KB Oct 1 2012 3:34 PM
99October.pdf PDF Document 270 KB Oct 1 2012 3:31 PM
99September.pdf PDF Document 271.5 KB Oct 1 2012 3:30 PM
100 Million Dead - JEWS AND COMMUNISM Part 1.htm HTML File 42.3 KB Oct 1 2012 3:28 PM
100 Million Dead - JEWS AND COMMUNISM Part 2.htm HTML File 41.3 KB Oct 1 2012 3:33 PM
100 Million Dead - JEWS AND COMMUNISM Part 3.htm HTML File 38.5 KB Oct 1 2012 3:28 PM
100ReasonsWereGladToBeMen.pdf PDF Document 6.5 KB Oct 1 2012 3:32 PM
100waystolivefree.pdf PDF Document 39.7 KB Oct 1 2012 3:31 PM
105HolocaustQuestions.pdf PDF Document 94.1 KB Oct 1 2012 3:30 PM
110.Eine_niedere_Form.pdf PDF Document 101.4 KB Oct 1 2012 3:33 PM
110.Geistige_Behinderung.pdf PDF Document 159.9 KB Oct 1 2012 3:32 PM
131Sample.pdf PDF Document 294.1 KB Oct 1 2012 3:30 PM
0208issue.html HTML File 158.6 KB Oct 1 2012 3:28 PM
0209issue.html HTML File 125.6 KB Oct 1 2012 3:28 PM
0210issue.html HTML File 145.3 KB Oct 1 2012 3:32 PM
0211issue.html HTML File 135.3 KB Oct 1 2012 3:28 PM
0212issue.html HTML File 136.7 KB Oct 1 2012 3:29 PM
260 million CHRISTIAN Lives Lost.htm HTML File 53.1 KB Oct 1 2012 3:31 PM
0301issue.html HTML File 147.6 KB Oct 1 2012 3:31 PM
0302issue.html HTML File 136.1 KB Oct 1 2012 3:34 PM
0303issue.html HTML File 143.1 KB Oct 1 2012 3:31 PM
0304issue.html HTML File 139.3 KB Oct 1 2012 3:32 PM
0305issue.html HTML File 142.7 KB Oct 1 2012 3:33 PM
0306issue.html HTML File 155.3 KB Oct 1 2012 3:30 PM
0307issue.html HTML File 155 KB Oct 1 2012 3:30 PM
0308issue.html HTML File 156.4 KB Oct 1 2012 3:33 PM
0309issue.html HTML File 147.5 KB Oct 1 2012 3:33 PM
0310issue.html HTML File 113.2 KB Oct 1 2012 3:32 PM
0311issue.html HTML File 150.6 KB Oct 1 2012 3:33 PM
0312issue.htm HTML File 137.1 KB Oct 1 2012 3:31 PM
365days.pdf PDF Document 13.6 MB Oct 1 2012 3:30 PM
0401issue.html HTML File 150 KB Oct 1 2012 3:31 PM
0402issue.html HTML File 147.3 KB Oct 1 2012 3:30 PM
0403issue.html HTML File 144.2 KB Oct 1 2012 3:30 PM
0404issue.html HTML File 154.2 KB Oct 1 2012 3:31 PM
0405issue.html HTML File 143.6 KB Oct 1 2012 3:30 PM
0406issue.html HTML File 151.1 KB Oct 1 2012 3:29 PM
0407issue.html HTML File 143.7 KB Oct 1 2012 3:27 PM
0408issue.html HTML File 147.6 KB Oct 1 2012 3:30 PM
0409issue.html HTML File 153.4 KB Oct 1 2012 3:28 PM
0410issue.html HTML File 153.1 KB Oct 1 2012 3:28 PM
0411issue.htm HTML File 147.7 KB Oct 1 2012 3:33 PM
0412issue.html HTML File 142.7 KB Oct 1 2012 3:32 PM
0506wiesendemo.pdf PDF Document 226.2 KB Oct 1 2012 3:29 PM
911issue.html HTML File 61 KB Oct 1 2012 3:32 PM
911report.pdf PDF Document 7.2 MB Oct 1 2012 3:28 PM
911report.rtf RTF File 14.6 MB Oct 1 2012 3:34 PM
912issue.html HTML File 59.2 KB Oct 1 2012 3:30 PM
913issue.html HTML File 59.9 KB Oct 1 2012 3:32 PM
914issue.html HTML File 57.1 KB Oct 1 2012 3:28 PM
915issue.html HTML File 61.5 KB Oct 1 2012 3:34 PM
916issue.html HTML File 66.4 KB Oct 1 2012 3:28 PM
921issue.html HTML File 75.8 KB Oct 1 2012 3:28 PM
922issue.html HTML File 63.7 KB Oct 1 2012 3:34 PM
923issue.html HTML File 65 KB Oct 1 2012 3:29 PM
924issue.html HTML File 61.3 KB Oct 1 2012 3:33 PM
925issue.html HTML File 64.1 KB Oct 1 2012 3:28 PM
926issue.html HTML File 74.1 KB Oct 1 2012 3:34 PM
927issue.html HTML File 60.8 KB Oct 1 2012 3:29 PM
928issue.html HTML File 62.7 KB Oct 1 2012 3:31 PM
931issue.html HTML File 63.6 KB Oct 1 2012 3:31 PM
932issue.html HTML File 59.3 KB Oct 1 2012 3:33 PM
933issue.html HTML File 60.5 KB Oct 1 2012 3:28 PM
934issue.html HTML File 62.1 KB Oct 1 2012 3:31 PM
935issue.html HTML File 62.3 KB Oct 1 2012 3:31 PM
936issue.html HTML File 60.6 KB Oct 1 2012 3:28 PM
937issue.html HTML File 60.7 KB Oct 1 2012 3:31 PM
938issue.html HTML File 61.1 KB Oct 1 2012 3:28 PM
939issue.html HTML File 119.7 KB Oct 1 2012 3:34 PM
941issue.html HTML File 63.6 KB Oct 1 2012 3:30 PM
942issue.html HTML File 57.5 KB Oct 1 2012 3:32 PM
943issue.html HTML File 59.3 KB Oct 1 2012 3:33 PM
944issue.html HTML File 56.9 KB Oct 1 2012 3:34 PM
945issue.html HTML File 58.7 KB Oct 1 2012 3:30 PM
946issue.html HTML File 56.8 KB Oct 1 2012 3:33 PM
947issue.html HTML File 64 KB Oct 1 2012 3:34 PM
948issue.html HTML File 70 KB Oct 1 2012 3:34 PM
949issue.html HTML File 71.7 KB Oct 1 2012 3:31 PM
951issue.html HTML File 78.4 KB Oct 1 2012 3:28 PM
952issue.html HTML File 82.6 KB Oct 1 2012 3:28 PM
953issue.html HTML File 80.5 KB Oct 1 2012 3:34 PM
954issue.html HTML File 75.8 KB Oct 1 2012 3:31 PM
955issue.html HTML File 78.2 KB Oct 1 2012 3:32 PM
956issue.html HTML File 76.3 KB Oct 1 2012 3:31 PM
957issue.html HTML File 80.3 KB Oct 1 2012 3:27 PM
958issue.html HTML File 79.5 KB Oct 1 2012 3:30 PM
959issue.html HTML File 80.9 KB Oct 1 2012 3:30 PM
961issue.html HTML File 81.4 KB Oct 1 2012 3:33 PM
962issue.html HTML File 82.4 KB Oct 1 2012 3:28 PM
963issue.html HTML File 77.7 KB Oct 1 2012 3:28 PM
964issue.html HTML File 78.3 KB Oct 1 2012 3:28 PM
965issue.html HTML File 75.7 KB Oct 1 2012 3:32 PM
966issue.html HTML File 70 KB Oct 1 2012 3:33 PM
967issue.html HTML File 79.4 KB Oct 1 2012 3:31 PM
968issue.html HTML File 73.7 KB Oct 1 2012 3:28 PM
969issue.html HTML File 77.5 KB Oct 1 2012 3:33 PM
971issue.html HTML File 83.3 KB Oct 1 2012 3:29 PM
972issue.html HTML File 81.1 KB Oct 1 2012 3:30 PM
973issue.html HTML File 92.1 KB Oct 1 2012 3:32 PM
974issue.html HTML File 79.7 KB Oct 1 2012 3:34 PM
975issue.html HTML File 77 KB Oct 1 2012 3:34 PM
976issue.html HTML File 87.7 KB Oct 1 2012 3:31 PM
979issue.html HTML File 84.7 KB Oct 1 2012 3:33 PM
981issue.html HTML File 89.1 KB Oct 1 2012 3:33 PM
982issue.html HTML File 93.9 KB Oct 1 2012 3:27 PM
983issue.html HTML File 84.6 KB Oct 1 2012 3:28 PM
984issue.html HTML File 82.2 KB Oct 1 2012 3:31 PM
985issue.html HTML File 78.4 KB Oct 1 2012 3:33 PM
986issue.html HTML File 77.2 KB Oct 1 2012 3:33 PM
987issue.html HTML File 82.1 KB Oct 1 2012 3:30 PM
988issue.html HTML File 76.2 KB Oct 1 2012 3:34 PM
989issue.html HTML File 77.8 KB Oct 1 2012 3:31 PM
991issue.html HTML File 119.4 KB Oct 1 2012 3:31 PM
992issue.html HTML File 111 KB Oct 1 2012 3:33 PM
993issue.html HTML File 118.3 KB Oct 1 2012 3:28 PM
994issue.html HTML File 111.1 KB Oct 1 2012 3:30 PM
995issue.html HTML File 76.8 KB Oct 1 2012 3:33 PM
996issue.html HTML File 85.3 KB Oct 1 2012 3:31 PM
997issue.html HTML File 102.9 KB Oct 1 2012 3:28 PM
998issue.html HTML File 85 KB Oct 1 2012 3:31 PM
999issue.html HTML File 111.2 KB Oct 1 2012 3:28 PM
1984.pdf PDF Document 564.4 KB Oct 1 2012 3:28 PM
1984.rtf RTF File 712.5 KB Oct 1 2012 3:33 PM
1984.zip ZIP Archive 367.4 KB Oct 1 2012 3:33 PM
2005-12-07 - Wanted - More Race Realism, Less Moralistic.htm HTML File 44.9 KB Oct 1 2012 3:28 PM
2005-12-07 - wanted_more_race_realism_less.php.htm HTML File 362.8 KB Oct 1 2012 3:28 PM
5700IsraelAid.pdf PDF Document 138.8 KB Oct 1 2012 3:33 PM
9011issue.html HTML File 60.4 KB Oct 1 2012 3:31 PM
9012issue.html HTML File 60.5 KB Oct 1 2012 3:30 PM
9107issue.html HTML File 60.5 KB Oct 1 2012 3:33 PM
9108issue.html HTML File 64.1 KB Oct 1 2012 3:34 PM
9109issue.html HTML File 56 KB Oct 1 2012 3:33 PM
9110issue.html HTML File 67.2 KB Oct 1 2012 3:33 PM
9111issue.html HTML File 58.1 KB Oct 1 2012 3:33 PM
9112issue.html HTML File 62.5 KB Oct 1 2012 3:33 PM
9209issue.html HTML File 62.1 KB Oct 1 2012 3:28 PM
9210issue.html HTML File 65 KB Oct 1 2012 3:33 PM
9211issue.html HTML File 62 KB Oct 1 2012 3:33 PM
9212issue.html HTML File 62.9 KB Oct 1 2012 3:30 PM
9311issue.html HTML File 60.5 KB Oct 1 2012 3:27 PM
9312issue.html HTML File 58.7 KB Oct 1 2012 3:34 PM
9410issue.html HTML File 61.5 KB Oct 1 2012 3:29 PM
9411issue.html HTML File 65.6 KB Oct 1 2012 3:30 PM
9412issue.html HTML File 74.2 KB Oct 1 2012 3:29 PM
9501ar.pdf PDF Document 434.4 KB Oct 1 2012 3:33 PM
9510issue.html HTML File 79.5 KB Oct 1 2012 3:32 PM
9511issue.html HTML File 80.7 KB Oct 1 2012 3:31 PM
9512issue.html HTML File 76.6 KB Oct 1 2012 3:33 PM
9610issue.html HTML File 74.1 KB Oct 1 2012 3:32 PM
9611issue.html HTML File 78.7 KB Oct 1 2012 3:32 PM
9612issue.html HTML File 80.1 KB Oct 1 2012 3:32 PM
9710issue.html HTML File 81.6 KB Oct 1 2012 3:32 PM
9711issue.html HTML File 80.8 KB Oct 1 2012 3:32 PM
9712issue.html HTML File 104.5 KB Oct 1 2012 3:31 PM
9778issue.html HTML File 172.9 KB Oct 1 2012 3:28 PM
9810issue.html HTML File 75 KB Oct 1 2012 3:30 PM
9811issue.html HTML File 73.8 KB Oct 1 2012 3:32 PM
9812issue.html HTML File 74.5 KB Oct 1 2012 3:27 PM
9910issue.html HTML File 77.4 KB Oct 1 2012 3:32 PM
9911issue.html HTML File 79.9 KB Oct 1 2012 3:29 PM
9912issue.html HTML File 100.2 KB Oct 1 2012 3:34 PM
41839.web.pdf PDF Document 11 KB Oct 1 2012 3:32 PM
45777355.html HTML File 30.9 KB Oct 1 2012 3:28 PM
Abandoned and Betrayed.htm HTML File 5.3 KB Oct 1 2012 3:30 PM
Abandoned Gold Standard Guarantees Inflation.htm HTML File 15.1 KB Oct 1 2012 3:31 PM
ABC Targets White Children.htm HTML File 7.6 KB Oct 1 2012 3:29 PM
about - THE CHURCH OF TRUE ISRAEL.html HTML File 6.8 KB Oct 1 2012 3:34 PM
Accused Negro Sniper to 'Question' His White Victim.htm HTML File 1.8 KB Oct 1 2012 3:31 PM
ACLU Top Heavy with Jews.htm HTML File 6.8 KB Oct 1 2012 3:27 PM
adaptanddie.pdf PDF Document 365.1 KB Oct 1 2012 3:31 PM
adaptanddie.rtf RTF File 186.3 KB Oct 1 2012 3:28 PM
A Date with Bevin.htm HTML File 4.1 KB Oct 1 2012 3:28 PM
ADL's Foxman - New Testament is Anti-Semitic.htm HTML File 2.4 KB Oct 1 2012 3:28 PM
ADL Anti-Defamation League of B'nai B'rith conducts smear campaigns - ADL Anti-Defamation League of B'nai B'rith is caught in cover-up of its crimes.htm HTML File 57.5 KB Oct 1 2012 3:34 PM
ADL Briefs U.S. House on Internet 'Hate'.htm HTML File 3.5 KB Oct 1 2012 3:33 PM
ADL Champions Gay Marriage, Calls Opponents 'Ugly Bigots'.htm HTML File 2.7 KB Oct 1 2012 3:31 PM
ADL Demands Gulag for Dissenters.htm HTML File 3.5 KB Oct 1 2012 3:34 PM
adlfactsheet1.pdf PDF Document 188.6 KB Oct 1 2012 3:27 PM
ADL Führer Warns of 'Intermarriage' and Public Schooling.htm HTML File 5.5 KB Oct 1 2012 3:28 PM
ADL Opponents Officially Designated As 'Terrorist Organizations'.htm HTML File 6.5 KB Oct 1 2012 3:27 PM
Adorno's Bastards and the Frankfurt School.htm HTML File 53.2 KB Oct 1 2012 3:32 PM
Ads Declare Population Driven Environmental Crisis In California.htm HTML File 4.2 KB Oct 1 2012 3:30 PM
adv-music.html HTML File 2.7 KB Oct 1 2012 3:34 PM
adv-tapes.html HTML File 9.1 KB Oct 1 2012 3:33 PM
adv010194.html HTML File 21.7 KB Oct 1 2012 3:29 PM
adv010894.html HTML File 16.9 KB Oct 1 2012 3:29 PM
adv011594.html HTML File 17.5 KB Oct 1 2012 3:33 PM
adv012994.html HTML File 21.2 KB Oct 1 2012 3:28 PM
adv020594.html HTML File 18.1 KB Oct 1 2012 3:31 PM
adv021994.html HTML File 19.9 KB Oct 1 2012 3:33 PM
adv022093.html HTML File 19.3 KB Oct 1 2012 3:31 PM
adv022496.html HTML File 15.3 KB Oct 1 2012 3:31 PM
adv022793.html HTML File 17.8 KB Oct 1 2012 3:34 PM
adv030594.html HTML File 19.9 KB Oct 1 2012 3:30 PM
adv031294.html HTML File 20.1 KB Oct 1 2012 3:30 PM
adv031393.html HTML File 19.3 KB Oct 1 2012 3:28 PM
adv031994.html HTML File 22.3 KB Oct 1 2012 3:31 PM
adv032093.html HTML File 17.4 KB Oct 1 2012 3:32 PM
adv040293.html HTML File 18.3 KB Oct 1 2012 3:28 PM
adv040393.html HTML File 6 KB Oct 1 2012 3:33 PM
adv041093.html HTML File 15.9 KB Oct 1 2012 3:27 PM
adv042493.html HTML File 18.9 KB Oct 1 2012 3:31 PM
adv043094.html HTML File 17.4 KB Oct 1 2012 3:28 PM
adv050193.html HTML File 19.9 KB Oct 1 2012 3:29 PM
adv050794.html HTML File 18.2 KB Oct 1 2012 3:28 PM
adv052993.html HTML File 18.7 KB Oct 1 2012 3:30 PM
adv060593.html HTML File 19.7 KB Oct 1 2012 3:28 PM
adv061293.html HTML File 21.6 KB Oct 1 2012 3:28 PM
adv061993.html HTML File 20.7 KB Oct 1 2012 3:30 PM
adv071093a.html HTML File 17.8 KB Oct 1 2012 3:28 PM
adv071093b.html HTML File 20.4 KB Oct 1 2012 3:30 PM
adv072493.html HTML File 20.3 KB Oct 1 2012 3:28 PM
adv080793.html HTML File 21.4 KB Oct 1 2012 3:29 PM
adv081493.html HTML File 20.4 KB Oct 1 2012 3:34 PM
adv082193.html HTML File 20.3 KB Oct 1 2012 3:30 PM
adv082893.html HTML File 19.9 KB Oct 1 2012 3:33 PM
adv091193.html HTML File 19.1 KB Oct 1 2012 3:34 PM
adv091893.html HTML File 16.5 KB Oct 1 2012 3:31 PM
adv092593.html HTML File 18.7 KB Oct 1 2012 3:33 PM
adv10-15-05.pdf PDF Document 296 KB Oct 1 2012 3:33 PM
adv100293.html HTML File 19.7 KB Oct 1 2012 3:33 PM
adv100792.html HTML File 19.3 KB Oct 1 2012 3:32 PM
adv101594.html HTML File 60.8 KB Oct 1 2012 3:30 PM
adv102393.html HTML File 20.1 KB Oct 1 2012 3:30 PM
adv103093.html HTML File 17.2 KB Oct 1 2012 3:31 PM
adv110693.html HTML File 17.6 KB Oct 1 2012 3:31 PM
adv111393.html HTML File 18.1 KB Oct 1 2012 3:27 PM
adv120493.html HTML File 17.9 KB Oct 1 2012 3:33 PM
adv122593.html HTML File 19.9 KB Oct 1 2012 3:30 PM
Advice on building an electric car for those interested.htm HTML File 96 KB Oct 1 2012 3:31 PM
aet.pdf PDF Document 1.5 MB Oct 1 2012 3:33 PM
Africa In Our Midst - Lessons From Katrina.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
African 'Culture' Spreads HIV.htm HTML File 3.4 KB Oct 1 2012 3:32 PM
After Millennia in India, Lost Tribe Returns to Israel.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
after_apartheid.pdf PDF Document 770.4 KB Oct 1 2012 3:28 PM
agapintestscoresbecomesatalkingpoint.html HTML File 7.5 KB Oct 1 2012 3:33 PM
AgentProvocateur.pdf PDF Document 6.8 KB Oct 1 2012 3:33 PM
Agitprop.htm HTML File 4.8 KB Oct 1 2012 3:31 PM
A Great Day in L.A..htm HTML File 9.5 KB Oct 1 2012 3:31 PM
A Group of Friends - Magnet For A Lonely America.htm HTML File 6.8 KB Oct 1 2012 3:33 PM
aids.pdf PDF Document 260.9 KB Oct 1 2012 3:34 PM
AIDS Alert! Avoid Sugar Daddies!.htm HTML File 2.3 KB Oct 1 2012 3:33 PM
AIDS Epidemic Among Black Elite.htm HTML File 3.2 KB Oct 1 2012 3:33 PM
aidsworkersbattlemythandignorance.html HTML File 6.5 KB Oct 1 2012 3:27 PM
aidtoisrael.pdf PDF Document 96.2 KB Oct 1 2012 3:34 PM
AIPAC, the Religious Right and American Foreign Policy.htm HTML File 33.8 KB Oct 1 2012 3:28 PM
AIPAC Congratulates Itself on the Slaughter in Lebanon.htm HTML File 3.1 KB Oct 1 2012 3:33 PM
AIPAC Espionage Case Dismissal Gambit Fails.htm HTML File 3.6 KB Oct 1 2012 3:31 PM
AIPAC Scandal Breaks Loose.htm HTML File 2.6 KB Oct 1 2012 3:29 PM
AIPAC Warns Dems Not to Appear at Anti-war Demo.htm HTML File 2.8 KB Oct 1 2012 3:30 PM
airport_flier_1.pdf PDF Document 238.6 KB Oct 1 2012 3:33 PM
Alabama - Immigrants Make School Rolls Larger than Town.htm HTML File 3.1 KB Oct 1 2012 3:33 PM
Alan Stang - 2004-01-16 - 'Martin Luther' King - Communist Fraud.htm HTML File 26.6 KB Oct 1 2012 3:28 PM
Ali G Worries ADL.htm HTML File 2.6 KB Oct 1 2012 3:33 PM
Alleged Racial-Beating Victim Admits Concocting Story.htm HTML File 3.9 KB Oct 1 2012 3:29 PM
allies.pdf PDF Document 592.7 KB Oct 1 2012 3:33 PM
A Look Back at Revisionism.htm HTML File 116 KB Oct 1 2012 3:27 PM
Alpin MacLaren - 2006-01-06 - Cold Turkey - Multiracialism is destroying our schools.htm HTML File 21.8 KB Oct 1 2012 3:27 PM
Alpin MacLaren - 2006-02-09 - Civil Wrongs.htm HTML File 21.6 KB Oct 1 2012 3:31 PM
Alpin MacLaren - 2006-03-02 - When Logic Fails.htm HTML File 8.9 KB Oct 1 2012 3:31 PM
A Man Named Arkan.htm HTML File 8.8 KB Oct 1 2012 3:30 PM
AMAZING ISSUE WITH TARGET.TXT Text File 1.9 KB Oct 1 2012 3:28 PM
America's Middle Class Shrinking in Globalist Economy.htm HTML File 2.8 KB Oct 1 2012 3:31 PM
America's Most Powerful Hate Group.htm HTML File 14.3 KB Oct 1 2012 3:31 PM
America Disappearing.htm HTML File 3.2 KB Oct 1 2012 3:28 PM
America Firster Jew Exposes Israel and the Zionist Network.htm HTML File 87.4 KB Oct 1 2012 3:34 PM
American Literature Sequence.pdf PDF Document 481.6 KB Oct 1 2012 3:28 PM
Americans Say Enough is Enough! Miller Beer Boycott Update.htm HTML File 10.1 KB Oct 1 2012 3:28 PM
american_haters2.pdf PDF Document 704.2 KB Oct 1 2012 3:34 PM
Amerika Text Uploads.sit SIT Archive 488.7 KB Oct 1 2012 3:33 PM
Amid Katrina Chaos, Congressman Used National Guard to Visit Home.htm HTML File 3.2 KB Oct 1 2012 3:33 PM
A Mile Too Far.htm HTML File 26.5 KB Oct 1 2012 3:33 PM
A Minuteman Boosts Border Overhaul Reform.htm HTML File 4.7 KB Oct 1 2012 3:30 PM
amusing_bible.zip ZIP Archive 365.3 KB Oct 1 2012 3:33 PM
amusing_gospel.zip ZIP Archive 341.2 KB Oct 1 2012 3:34 PM
Anarcho-Tyranny—Where Multiculturalism Leads.htm HTML File 7 KB Oct 1 2012 3:29 PM
A National Emergency.htm HTML File 2.4 KB Oct 1 2012 3:28 PM
Andrew Young Pulls a 'Mel Gibson'.htm HTML File 4.6 KB Oct 1 2012 3:32 PM
A New Commission for a New Era.htm HTML File 2.9 KB Oct 1 2012 3:32 PM
AnimalFarm.pdf PDF Document 224.6 KB Oct 1 2012 3:30 PM
AnneFrankFraud.pdf PDF Document 111.4 KB Oct 1 2012 3:31 PM
Another Anti-White Race-Hate Murder Ignored by National Media.htm HTML File 6.2 KB Oct 1 2012 3:28 PM
Anti-Child-Molester Protest Stopped by 'Anti-Fascist Action'.htm HTML File 3 KB Oct 1 2012 3:27 PM
Anti-White Discrimination Plagues European Art Scene.htm HTML File 2.9 KB Oct 1 2012 3:33 PM
Anti-White Hate Crimes.rtf RTF File 18.1 KB Oct 1 2012 3:30 PM
Anti-White Quotes.txt Text File 12.1 KB Oct 1 2012 3:28 PM
antichrist.htm HTML File 198 KB Oct 1 2012 3:33 PM
AntiHumans.pdf PDF Document 599.7 KB Oct 1 2012 3:31 PM
antiracism.htm HTML File 47.7 KB Oct 1 2012 3:33 PM
antisemitismcauses.pdf PDF Document 990.6 KB Oct 1 2012 3:29 PM
antisemitismcauses.rtf RTF File 547.7 KB Oct 1 2012 3:34 PM
A Once Great Britain.htm HTML File 7.2 KB Oct 1 2012 3:30 PM
AP.pdf PDF Document 201.3 KB Oct 1 2012 3:29 PM
AP.rtf RTF File 246.9 KB Oct 1 2012 3:31 PM
Apartheid State of Israel Expands Colonization of Golan Heights.htm HTML File 3.9 KB Oct 1 2012 3:27 PM
AP In Hurricane 'Moral Equivalency' Hassle.htm HTML File 4.9 KB Oct 1 2012 3:28 PM
AP Interviews Geert Wilders.htm HTML File 3.2 KB Oct 1 2012 3:33 PM
Apocalypse at Dresden - The Worst Massacre in the History of the World.htm HTML File 38.9 KB Oct 1 2012 3:32 PM
apology.htm HTML File 14.2 KB Oct 1 2012 3:28 PM
Apparent Drug Overdose Claims Life of National Vanguard Foe.htm HTML File 3.4 KB Oct 1 2012 3:34 PM
application.pdf PDF Document 396 KB Oct 1 2012 3:31 PM
Apr01.pdf PDF Document 1.1 MB Oct 1 2012 3:33 PM
Apr02.pdf PDF Document 1.4 MB Oct 1 2012 3:28 PM
Apr03.pdf PDF Document 1 MB Oct 1 2012 3:29 PM
Apr04.pdf PDF Document 1.2 MB Oct 1 2012 3:32 PM
Apr05-1.pdf PDF Document 636.9 KB Oct 1 2012 3:33 PM
April 30, 1863 - The Battle of Camarón.htm HTML File 8.9 KB Oct 1 2012 3:31 PM
Ar-fly.pdf PDF Document 114.3 KB Oct 1 2012 3:34 PM
AR2006041001423_pf.html HTML File 11.7 KB Oct 1 2012 3:33 PM
AR2006041200149.html HTML File 67.1 KB Oct 1 2012 3:31 PM
AR2006041200477.html HTML File 71.6 KB Oct 1 2012 3:33 PM
Arabs and Slave Trade.htm HTML File 11.5 KB Oct 1 2012 3:28 PM
arabtransfer.pdf PDF Document 2.1 MB Oct 1 2012 3:30 PM
arabtransfer.rtf RTF File 1.6 MB Oct 1 2012 3:31 PM
AreJewsARace.pdf PDF Document 463.8 KB Oct 1 2012 3:31 PM
A review of La convergence des catastrophes by Guillaume Corvus.htm HTML File 46.7 KB Oct 1 2012 3:30 PM
areyouawhiteman.pdf PDF Document 62.4 KB Oct 1 2012 3:33 PM
Arm Against 'Katricians,' Gun Dealers Tell Houston.htm HTML File 53.3 KB Oct 1 2012 3:31 PM
ArmingAmericaFraud.pdf PDF Document 27.5 KB Oct 1 2012 3:27 PM
Artful Anecdotes.htm HTML File 7.1 KB Oct 1 2012 3:28 PM
article7545.htm HTML File 14 KB Oct 1 2012 3:33 PM
asgard-pdf.zip ZIP Archive 822.6 KB Oct 1 2012 3:32 PM
Asians Murder British Lad for Being White.htm HTML File 2.9 KB Oct 1 2012 3:28 PM
A Split In the Racist Right.htm HTML File 21.4 KB Oct 1 2012 3:32 PM
Assassination Attempt on David Duke.htm HTML File 4.6 KB Oct 1 2012 3:29 PM
Assault Arrest Followed Word to Cheney.htm HTML File 2.8 KB Oct 1 2012 3:33 PM
A theory of Einstein the irrational plagiarist.htm HTML File 40.4 KB Oct 1 2012 3:31 PM
At Least 5 Killed By Police In New Orleans (Bad Guys Killed-Not Contractors).htm HTML File 63.1 KB Oct 1 2012 3:31 PM
audio.html HTML File 57.6 KB Oct 1 2012 3:30 PM
audiovideo2.htm HTML File 32.6 KB Oct 1 2012 3:29 PM
Aug01.pdf PDF Document 655.8 KB Oct 1 2012 3:28 PM
Aug02.pdf PDF Document 1.7 MB Oct 1 2012 3:30 PM
Aug03.pdf PDF Document 611.7 KB Oct 1 2012 3:31 PM
Aug04.pdf PDF Document 671.5 KB Oct 1 2012 3:31 PM
August 23, 1917 - Black Mutiny Leaves 16 Whites Dead.htm HTML File 5.4 KB Oct 1 2012 3:27 PM
auschwitzbunkers.pdf PDF Document 6.2 MB Oct 1 2012 3:33 PM
auschwitzplainfacts.pdf PDF Document 1.5 MB Oct 1 2012 3:29 PM
auschwitzplainfacts.rtf RTF File 2.1 MB Oct 1 2012 3:33 PM
AussieNationalism.pdf PDF Document 1.1 MB Oct 1 2012 3:31 PM
Australia - Rape Gangs and Multiracialism.htm HTML File 11.3 KB Oct 1 2012 3:33 PM
Austrian court confirms British historian guilty of Holocaust denial.htm HTML File 4.8 KB Oct 1 2012 3:33 PM
Austrians Fed Up With Kosher Arnie.htm HTML File 4.4 KB Oct 1 2012 3:32 PM
Autumnal Equinox Comes.htm HTML File 4.2 KB Oct 1 2012 3:33 PM
A V-Reader Gives Belgians a Message.htm HTML File 3.7 KB Oct 1 2012 3:28 PM
av.html HTML File 56.5 KB Oct 1 2012 3:27 PM
AvoidAIDS.pdf PDF Document 260.9 KB Oct 1 2012 3:28 PM
Avoid Mestizos - AIDS Rampant Among Mestizos.htm HTML File 2 KB Oct 1 2012 3:33 PM
A White College Student's Guide to Political Activism.htm HTML File 29.6 KB Oct 1 2012 3:27 PM
A White Future is Coming - an interview with Bob Whitaker.htm HTML File 26.5 KB Oct 1 2012 3:30 PM
A White Majority For New Orleans.htm HTML File 4 KB Oct 1 2012 3:31 PM
awmso.rtf RTF File 568.4 KB Oct 1 2012 3:33 PM
awmso.zip ZIP Archive 453.9 KB Oct 1 2012 3:32 PM
Axe Wielding Albanian Mob Brutally Assaults Elderly Serb Couple in Kosovo.htm HTML File 2.8 KB Oct 1 2012 3:30 PM
Aztecs Butchered, Ate Prisoners.htm HTML File 3.5 KB Oct 1 2012 3:27 PM
B&H Field Manual.pdf PDF Document 301.1 KB Oct 1 2012 3:31 PM
Background on the Jewish Defense Organization.htm HTML File 2.9 KB Oct 1 2012 3:33 PM
Back to...Homeschool.htm HTML File 3.1 KB Oct 1 2012 3:27 PM
Ban-Crazy Brits Nix St. George Again.htm HTML File 3.1 KB Oct 1 2012 3:33 PM
baraktriestoresolveplanedispute.html HTML File 5.8 KB Oct 1 2012 3:33 PM
barriers.pdf PDF Document 245.7 KB Oct 1 2012 3:34 PM
Baton Rouge Whites Mob Gun Stores.htm HTML File 5.1 KB Oct 1 2012 3:32 PM
BBC To Report On London Kabbalah Center.htm HTML File 13.1 KB Oct 1 2012 3:30 PM
BeastAsSaint.pdf PDF Document 135.8 KB Oct 1 2012 3:30 PM
BeastAsSaintNew.pdf PDF Document 76.8 KB Oct 1 2012 3:33 PM
Beauty, Art, and Race.htm HTML File 20.1 KB Oct 1 2012 3:31 PM
Behind the Mask of Respectability - The truth about the Anti-Defamation League of B'nai B'rith.htm HTML File 14.3 KB Oct 1 2012 3:29 PM
Belgian Police Raid Revisionists.htm HTML File 3.3 KB Oct 1 2012 3:30 PM
Belgium - Multicultural Fascism Now Official Policy.htm HTML File 6.4 KB Oct 1 2012 3:29 PM
Beloved Wagnerian Soprano Passes.htm HTML File 3.6 KB Oct 1 2012 3:34 PM
belzec.pdf PDF Document 3 MB Oct 1 2012 3:28 PM
Benedict Meets with Dissident Journalist.htm HTML File 3.3 KB Oct 1 2012 3:31 PM
Benedict to Meet with Traditionalists.htm HTML File 4.4 KB Oct 1 2012 3:28 PM
bengurionscandals.pdf PDF Document 513.6 KB Oct 1 2012 3:31 PM
bengurionscandals.rtf RTF File 680.9 KB Oct 1 2012 3:32 PM
Bergen's Lie.htm HTML File 3 KB Oct 1 2012 3:33 PM
beria.pdf PDF Document 318.4 KB Oct 1 2012 3:28 PM
Between the Jews and the Gentiles -- In the Aggadah, the Kabbalah, and in Jewish Thought.htm HTML File 61.1 KB Oct 1 2012 3:33 PM
Bevier Pamphlet JR.pdf PDF Document 207.9 KB Oct 1 2012 3:31 PM
Bevier_pamphlet.doc Microsoft Word Document 176.5 KB Oct 1 2012 3:32 PM
Beyonce - 'I Make Black Records'.htm HTML File 2.7 KB Oct 1 2012 3:32 PM
Beyond Chutzpah.htm HTML File 32.3 KB Oct 1 2012 3:33 PM
BibleTalmudQuotes.pdf PDF Document 106.6 KB Oct 1 2012 3:33 PM
biblography.html HTML File 8.2 KB Oct 1 2012 3:28 PM
Bill White - 2006-03-27 - National Socialism And The Klan.txt Text File 18.6 KB Oct 1 2012 3:33 PM
binLadenInterview.pdf PDF Document 79.4 KB Oct 1 2012 3:27 PM
biohazard.pdf PDF Document 284.7 KB Oct 1 2012 3:33 PM
biologicaljew.pdf PDF Document 244.9 KB Oct 1 2012 3:31 PM
biologicaljew.rtf RTF File 324.7 KB Oct 1 2012 3:33 PM
Birmingham Riots - Color is Only Skin Deep.htm HTML File 4 KB Oct 1 2012 3:31 PM
bks.bin BIN File 10.3 KB Oct 1 2012 3:29 PM
Black 'Jews' Accused in Israeli Welfare Scam.htm HTML File 6.3 KB Oct 1 2012 3:29 PM
blackamericaatwar.html HTML File 3.5 KB Oct 1 2012 3:32 PM
blackboxvoting.pdf PDF Document 971.7 KB Oct 1 2012 3:28 PM
Black Columnis - National Alliance Put Issue of Interracial Sex 'Out There'.htm HTML File 1.7 KB Oct 1 2012 3:31 PM
blackcrime.pdf PDF Document 408.8 KB Oct 1 2012 3:32 PM
Black Ex-Crack Salesman to Launch 'Books'.htm HTML File 4.5 KB Oct 1 2012 3:33 PM
Black God Begs Devil for Dignified Demise.htm HTML File 5.8 KB Oct 1 2012 3:31 PM
Black HUD Chief Foresees a 'Whiter' New Orleans.htm HTML File 4 KB Oct 1 2012 3:29 PM
BlackInnovation.pdf PDF Document 15.3 KB Oct 1 2012 3:27 PM
Black Leaders and the Demise of the OIC.htm HTML File 15.1 KB Oct 1 2012 3:30 PM
Black Muslim Update - Oakland Store Arab Kidnapped.htm HTML File 5.6 KB Oct 1 2012 3:32 PM
Blackness Tells It Like It Be.htm HTML File 5 KB Oct 1 2012 3:28 PM
Black Panther Foundation Seeks to Sell 'Burn Baby Burn' Hot Sauce.htm HTML File 2.3 KB Oct 1 2012 3:32 PM
Black Panthers Jailed in Cop-Killing Probe.htm HTML File 2.9 KB Oct 1 2012 3:34 PM
blackpupilslagdespiteeconomicstatus.html HTML File 6.6 KB Oct 1 2012 3:28 PM
blackpupilslosingoutindrivetoraisestandards.html HTML File 3.1 KB Oct 1 2012 3:31 PM
Black Rap Star Caught Using Sweat Shop Slaves.htm HTML File 1.7 KB Oct 1 2012 3:31 PM
Black Refugee Accused of Raping Retarded Girl.htm HTML File 3.4 KB Oct 1 2012 3:30 PM
blackscanthackcollegeegalitariansbaffled.html HTML File 12.8 KB Oct 1 2012 3:31 PM
blackscommit90percentofinterracialcrime.html HTML File 10 KB Oct 1 2012 3:30 PM
BlackSlaveOwners.pdf PDF Document 22 KB Oct 1 2012 3:31 PM
BlackSlaveOwners.rtf RTF File 33.4 KB Oct 1 2012 3:31 PM
Blacks on New Orleans Looting Rampage.htm HTML File 5.3 KB Oct 1 2012 3:28 PM
Black Supremacist Relies on White Science to Stay Alive.htm HTML File 3.5 KB Oct 1 2012 3:32 PM
blackswontgofarinparalleluniverse.html HTML File 4.2 KB Oct 1 2012 3:31 PM
Black US Employees Accused of Slave-driving in Africa.htm HTML File 3.8 KB Oct 1 2012 3:33 PM
Black Vikings Fumble 'Ethics'.htm HTML File 7.4 KB Oct 1 2012 3:32 PM
blackyouthcultureblamedaspupilsfail.html HTML File 5.8 KB Oct 1 2012 3:28 PM
black_history_month_1.pdf PDF Document 731.4 KB Oct 1 2012 3:31 PM
blfs-book-6.1.pdf PDF Document 3.2 MB Oct 1 2012 3:30 PM
Bloggers_Handbook2.pdf PDF Document 3.5 MB Oct 1 2012 3:28 PM
Blood on the Frost - Never Forget the Hmong Massacre.htm HTML File 23.3 KB Oct 1 2012 3:30 PM
BNP's Griffin - Asians Engage in Ethnic Cleansing in Oldham.htm HTML File 3.7 KB Oct 1 2012 3:28 PM
BNP Gets Voice on Yorkshire Race Council.htm HTML File 4.9 KB Oct 1 2012 3:30 PM
BNP Leader Affirms - Islam 'Wicked' Faith.htm HTML File 4.5 KB Oct 1 2012 3:31 PM
bolshevism.jpg JPEG Image 17.8 KB Oct 1 2012 3:27 PM
Bombs and Hurricanes - Our Struggle.htm HTML File 3.7 KB Oct 1 2012 3:31 PM
books-immigration.html HTML File 184 KB Oct 1 2012 3:28 PM
book_of_dead.zip ZIP Archive 1.1 MB Oct 1 2012 3:33 PM
boredoftherings.pdf PDF Document 230.4 KB Oct 1 2012 3:31 PM
boredoftherings.rtf RTF File 332.4 KB Oct 1 2012 3:31 PM
born_to_kill.jpg JPEG Image 13.1 KB Oct 1 2012 3:31 PM
Boycott Miller for Supporting Illegal Aliens and Illegal Immigration.htm HTML File 4.1 KB Oct 1 2012 3:32 PM
boycott_hd.pdf PDF Document 860.7 KB Oct 1 2012 3:29 PM
Brann - THE BUCK NEGRO.htm HTML File 13.3 KB Oct 1 2012 3:27 PM
brann.pdf PDF Document 67.4 KB Oct 1 2012 3:31 PM
breaking point.pdf PDF Document 97.6 KB Oct 1 2012 3:28 PM
brenner02192003.html HTML File 22.7 KB Oct 1 2012 3:32 PM
Brigham Young's Speech on Slavery, blacks and the Priesthood.htm HTML File 17.2 KB Oct 1 2012 3:33 PM
bringingdemocracytohaiti.html HTML File 27.3 KB Oct 1 2012 3:32 PM
Britain Recruited Muslim Terrorists.htm HTML File 3 KB Oct 1 2012 3:27 PM
Britain’s Racial Diversity Brings Murder; No Justice.htm HTML File 3 KB Oct 1 2012 3:28 PM
Britons Pay Price for Neo-Con Madness.htm HTML File 3.4 KB Oct 1 2012 3:27 PM
Briton tells of Katrina nightmare.htm HTML File 6.4 KB Oct 1 2012 3:29 PM
brochure.pdf PDF Document 1.9 MB Oct 1 2012 3:31 PM
Brooklyn-Based Jew Admits to Trafficking in Women.htm HTML File 4 KB Oct 1 2012 3:32 PM
Brooklyn - Black 'Students' Charged With Anti-White Race Attack.htm HTML File 2.5 KB Oct 1 2012 3:28 PM
Brooklyn Jew Ritually Murders Chickens.htm HTML File 2.1 KB Oct 1 2012 3:33 PM
BruderFlyer.pdf PDF Document 91.3 KB Oct 1 2012 3:30 PM
BugChasers.pdf PDF Document 58.4 KB Oct 1 2012 3:32 PM
Bush - It's All About the Spin.htm HTML File 2.8 KB Oct 1 2012 3:31 PM
Bush Buddy in Flap over Jewish 'Holy Water'.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
bushpoint2.jpg JPEG Image 7.3 KB Oct 1 2012 3:31 PM
Bush Speech Gave Race Hustlers Fresh Ammo.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
bush_911_2005.pdf PDF Document 218.7 KB Oct 1 2012 3:30 PM
bwbw.pdf PDF Document 990.5 KB Oct 1 2012 3:33 PM
By Way Of Deception.htm HTML File 29.2 KB Oct 1 2012 3:29 PM
By way of deception thou shalt do war.htm HTML File 39.1 KB Oct 1 2012 3:30 PM
California - April Gaede Awarded Queen Isabella Prize.htm HTML File 2.9 KB Oct 1 2012 3:34 PM
California - Minuteman Won Election Day Vote.htm HTML File 7 KB Oct 1 2012 3:31 PM
California - Pro-White Music At Folk The System.htm HTML File 10.4 KB Oct 1 2012 3:29 PM
California - Tookie's Son on the Run.htm HTML File 3.4 KB Oct 1 2012 3:33 PM
California - Tookie Executed.htm HTML File 2.6 KB Oct 1 2012 3:32 PM
California Initiative for State Border Police Gaining Ground.htm HTML File 4.7 KB Oct 1 2012 3:32 PM
Camp of the Saints.pdf PDF Document 18.1 KB Oct 1 2012 3:28 PM
Can 'Liberals' Be Educated.htm HTML File 45.2 KB Oct 1 2012 3:33 PM
Canadian Heritage Alliance Articles Letters to Newspapers .doc Microsoft Word Document 22.5 KB Oct 1 2012 3:30 PM
Cannibalism in the African Congo.htm HTML File 12.9 KB Oct 1 2012 3:33 PM
Cans of Paint, Two White Halves, and Chromosomes.htm HTML File 9.4 KB Oct 1 2012 3:31 PM
carplans.zip ZIP Archive 217.7 KB Oct 1 2012 3:32 PM
CarrsTestimony.pdf PDF Document 121.1 KB Oct 1 2012 3:34 PM
CarrsTestimony.rtf RTF File 238.1 KB Oct 1 2012 3:29 PM
catalog.pdf PDF Document 511.1 KB Oct 1 2012 3:29 PM
catalog_pdf0607.htm HTML File 7.4 KB Oct 1 2012 3:31 PM
Catastrophe In Kansas City.htm HTML File 34.6 KB Oct 1 2012 3:34 PM
Catholic Leaders Condemn Anti-Zionism.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
CattleRaidOfCooley.pdf PDF Document 1.2 MB Oct 1 2012 3:33 PM
ccm.pdf PDF Document 9.1 MB Oct 1 2012 3:31 PM
ccm.zip ZIP Archive 3 MB Oct 1 2012 3:33 PM
ccs.pdf PDF Document 8.3 MB Oct 1 2012 3:31 PM
cgc 1.pdf PDF Document 2.4 MB Oct 1 2012 3:33 PM
cgc2.pdf PDF Document 2.9 MB Oct 1 2012 3:30 PM
cgc3.pdf PDF Document 1.3 MB Oct 1 2012 3:29 PM
Challenging the Power of the Jewish Lobby - What Should Be Done.htm HTML File 22.2 KB Oct 1 2012 3:33 PM
Challenging the Power of the Jewish Lobby.htm HTML File 6.6 KB Oct 1 2012 3:30 PM
chapter01.html HTML File 4 KB Oct 1 2012 3:32 PM
chapter02.html HTML File 8 KB Oct 1 2012 3:32 PM
chapter03.html HTML File 10.6 KB Oct 1 2012 3:32 PM
chapter04.html HTML File 5.4 KB Oct 1 2012 3:30 PM
chapter05.html HTML File 5.3 KB Oct 1 2012 3:31 PM
chapter06.html HTML File 12.4 KB Oct 1 2012 3:31 PM
chapter07.html HTML File 15.1 KB Oct 1 2012 3:28 PM
chapter08.html HTML File 20.1 KB Oct 1 2012 3:32 PM
chapter09.html HTML File 4.4 KB Oct 1 2012 3:30 PM
chapter10.html HTML File 34.2 KB Oct 1 2012 3:33 PM
chapter11.html HTML File 13.6 KB Oct 1 2012 3:32 PM
chapter12.html HTML File 16.8 KB Oct 1 2012 3:28 PM
chapter13.html HTML File 12.6 KB Oct 1 2012 3:33 PM
chapter14.html HTML File 8.5 KB Oct 1 2012 3:33 PM
chapter15.html HTML File 20.8 KB Oct 1 2012 3:31 PM
chapter16.html HTML File 7.3 KB Oct 1 2012 3:30 PM
chapter17.html HTML File 8.2 KB Oct 1 2012 3:32 PM
chapter18.html HTML File 6.1 KB Oct 1 2012 3:29 PM
chapter19.html HTML File 10 KB Oct 1 2012 3:33 PM
chapter20.html HTML File 6.5 KB Oct 1 2012 3:29 PM
Chapt_01.htm HTML File 14.4 KB Oct 1 2012 3:31 PM
Chapt_02.htm HTML File 31.7 KB Oct 1 2012 3:33 PM
Chapt_03.htm HTML File 28.1 KB Oct 1 2012 3:31 PM
Chapt_04.htm HTML File 30.8 KB Oct 1 2012 3:31 PM
Chapt_05.htm HTML File 18.2 KB Oct 1 2012 3:33 PM
Chapt_06.htm HTML File 62.9 KB Oct 1 2012 3:33 PM
Chapt_07.htm HTML File 43.2 KB Oct 1 2012 3:33 PM
Chapt_08.htm HTML File 19.3 KB Oct 1 2012 3:31 PM
Chapt_09.htm HTML File 45.7 KB Oct 1 2012 3:30 PM
Chapt_10.htm HTML File 40.8 KB Oct 1 2012 3:27 PM
Chapt_11.htm HTML File 22.5 KB Oct 1 2012 3:28 PM
Chapt_12.htm HTML File 27.5 KB Oct 1 2012 3:31 PM
Chapt_13.htm HTML File 31.5 KB Oct 1 2012 3:27 PM
Chapt_14.htm HTML File 36.1 KB Oct 1 2012 3:31 PM
Chapt_15.htm HTML File 18.8 KB Oct 1 2012 3:33 PM
Chapt_16.htm HTML File 7.8 KB Oct 1 2012 3:28 PM
Chavez Condemned for 'Anti-Semitism'.htm HTML File 2.8 KB Oct 1 2012 3:32 PM
Cherishing an Older Catholicism.htm HTML File 2.5 KB Oct 1 2012 3:32 PM
Chertoff Aide Guilty in Child Porn Case.htm HTML File 5.2 KB Oct 1 2012 3:31 PM
Chertoff Claims He Didn't Have A Clue.htm HTML File 5.8 KB Oct 1 2012 3:30 PM
Chertoff Proposes Non-Profit Spying Group.htm HTML File 2.4 KB Oct 1 2012 3:33 PM
Chertoff Timeline.htm HTML File 10.1 KB Oct 1 2012 3:30 PM
chickenhawks.pdf PDF Document 1.2 MB Oct 1 2012 3:34 PM
Children - National Treasure or Personal Luxury Item.htm HTML File 3.9 KB Oct 1 2012 3:29 PM
China, Deflation And The Dollar.htm HTML File 32.6 KB Oct 1 2012 3:27 PM
chinacautionsisraelagainstsellingawacstoindia.html HTML File 3.5 KB Oct 1 2012 3:31 PM
chinadeploysdronesfromisrael.html HTML File 6.9 KB Oct 1 2012 3:34 PM
chinapreparesforwaragainsttheunitedstates.html HTML File 4.5 KB Oct 1 2012 3:30 PM
China Replaces U.S. As World's Largest Exporter.htm HTML File 6.4 KB Oct 1 2012 3:31 PM
chinasarsenalborninamerica.html HTML File 9 KB Oct 1 2012 3:28 PM
ChinaStealsUSMilitarySecrets.pdf PDF Document 639.7 KB Oct 1 2012 3:28 PM
chinesespyingandthewhitehouse.html HTML File 12.1 KB Oct 1 2012 3:32 PM
Chosen for Pornography.htm HTML File 2.6 KB Oct 1 2012 3:27 PM
Christian Colleges Offer Free Tuition to Katrina Refugees.htm HTML File 3.8 KB Oct 1 2012 3:28 PM
Christian Leaders Urge Third World Flood.htm HTML File 2.6 KB Oct 1 2012 3:30 PM
Christians in Jerusalem Want Jews to Stop Spitting on Them.htm HTML File 3.9 KB Oct 1 2012 3:30 PM
Church asks evacuee to leave.htm HTML File 9.3 KB Oct 1 2012 3:30 PM
Church fighting IRS over anti-war sermon won't give up documents.htm HTML File 8.6 KB Oct 1 2012 3:28 PM
churchillswar1.pdf PDF Document 5.8 MB Oct 1 2012 3:32 PM
churchillswar2.pdf PDF Document 5.1 MB Oct 1 2012 3:31 PM
Chutzpah - Zionists Running Anti-Slavery Organization.htm HTML File 13.2 KB Oct 1 2012 3:28 PM
ci.zip ZIP Archive 908.9 KB Oct 1 2012 3:31 PM
CISReport.pdf PDF Document 220.7 KB Oct 1 2012 3:30 PM
CitizensInformerWinter2005 - Small.pdf PDF Document 2.6 MB Oct 1 2012 3:31 PM
CivilDisobedience.pdf PDF Document 87.8 KB Oct 1 2012 3:31 PM
Civil War in Europe.htm HTML File 5.4 KB Oct 1 2012 3:31 PM
CLARITY.pdf PDF Document 87.6 KB Oct 1 2012 3:31 PM
classical_iq_r2.cgi.htm HTML File 23.6 KB Oct 1 2012 3:33 PM
clinton.pdf PDF Document 72 KB Oct 1 2012 3:31 PM
cofc.pdf PDF Document 1.9 MB Oct 1 2012 3:29 PM
CofCCguide.pdf PDF Document 49.2 KB Oct 1 2012 3:30 PM
collective_punishment.pdf PDF Document 218 KB Oct 1 2012 3:33 PM
color-brochure.pdf PDF Document 571.5 KB Oct 1 2012 3:33 PM
color2.html HTML File 8.7 KB Oct 1 2012 3:29 PM
Colorado - 57 Refugees Have Felony Records.htm HTML File 2.8 KB Oct 1 2012 3:33 PM
COLOR COMMUNISM AND COMMON SENSE.txt Text File 74.7 KB Oct 1 2012 3:34 PM
colorcrime99.pdf PDF Document 399.6 KB Oct 1 2012 3:29 PM
ColorOfCrime.pdf PDF Document 408.4 KB Oct 1 2012 3:31 PM
come-and-hear-complete.zip ZIP Archive 58.3 MB Oct 1 2012 3:28 PM
coming_soon.pdf PDF Document 479.4 KB Oct 1 2012 3:33 PM
communist.html HTML File 44.3 KB Oct 1 2012 3:32 PM
comm_1.html HTML File 48.2 KB Oct 1 2012 3:33 PM
CompilationPresentation.pdf PDF Document 6.3 MB Oct 1 2012 3:27 PM
complaintform_advertising.htm HTML File 2.9 KB Oct 1 2012 3:30 PM
complaintform_bank.htm HTML File 2.5 KB Oct 1 2012 3:33 PM
complaintform_banquet_service.htm HTML File 2.7 KB Oct 1 2012 3:33 PM
complaintform_barber_shop.htm HTML File 2.5 KB Oct 1 2012 3:28 PM
complaintform_beauty_parlor.htm HTML File 2.6 KB Oct 1 2012 3:28 PM
complaintform_church.htm HTML File 3.3 KB Oct 1 2012 3:33 PM
complaintform_department_store.htm HTML File 2.6 KB Oct 1 2012 3:30 PM
complaintform_ethnic_answering_service.htm HTML File 2.6 KB Oct 1 2012 3:28 PM
complaintform_hair_salon.htm HTML File 2.5 KB Oct 1 2012 3:31 PM
complaintform_hospital.htm HTML File 2.5 KB Oct 1 2012 3:32 PM
complaintform_hotel.htm HTML File 2.5 KB Oct 1 2012 3:31 PM
complaintform_motel.htm HTML File 2.5 KB Oct 1 2012 3:32 PM
complaintform_movie_race_mixing.htm HTML File 2.9 KB Oct 1 2012 3:33 PM
complaintform_news_show.htm HTML File 2.9 KB Oct 1 2012 3:34 PM
complaintform_physician_office.htm HTML File 2.5 KB Oct 1 2012 3:33 PM
complaintform_restaurant.htm HTML File 2.8 KB Oct 1 2012 3:33 PM
complaintform_school.htm HTML File 2.7 KB Oct 1 2012 3:32 PM
complaintform_service_station.htm HTML File 2.6 KB Oct 1 2012 3:33 PM
complaintform_store.htm HTML File 2.5 KB Oct 1 2012 3:30 PM
complaintform_theatre.htm HTML File 2.5 KB Oct 1 2012 3:27 PM
CompleteGuide.html HTML File 94.4 KB Oct 1 2012 3:33 PM
Confirmed - Snipers Black.htm HTML File 2.4 KB Oct 1 2012 3:32 PM
Congressional Black Caucus Holds Press Conference.htm HTML File 5.3 KB Oct 1 2012 3:33 PM
Congressman Apologizes, Denies Assaulting Mistress.htm HTML File 2.9 KB Oct 1 2012 3:31 PM
Conservatives; They Refuse to Call It What It Really Is - Genocide.htm HTML File 19.4 KB Oct 1 2012 3:30 PM
Contemporary Trotskyism.htm HTML File 14.4 KB Oct 1 2012 3:31 PM
Controlled Media - Forget the Facts About Katrina.htm HTML File 8.6 KB Oct 1 2012 3:28 PM
ControversyOfZion.pdf PDF Document 1.6 MB Oct 1 2012 3:31 PM
convoypq17.pdf PDF Document 2.5 MB Oct 1 2012 3:30 PM
Corrupting Our Police.htm HTML File 19.9 KB Oct 1 2012 3:28 PM
cosmoe.pdf PDF Document 171.7 KB Oct 1 2012 3:31 PM
cosmosymbol.pdf PDF Document 59.7 KB Oct 1 2012 3:28 PM
Cosmotheism.pdf PDF Document 194.5 KB Oct 1 2012 3:30 PM
Cosmotheism.rtf RTF File 63.8 KB Oct 1 2012 3:31 PM
CostOfIsraelToUS.pdf PDF Document 25.6 KB Oct 1 2012 3:33 PM
CostOfUSMideastPolicy.pdf PDF Document 96.4 KB Oct 1 2012 3:34 PM
Court Temporarily OKs Domestic Spying.htm HTML File 2.6 KB Oct 1 2012 3:28 PM
Court to Tookie - No Thanks, Snitch.htm HTML File 4.4 KB Oct 1 2012 3:33 PM
Covering the 'Kwa - The Inflexible, Utterly Predictable and Parody-Worthy Coverage of Race by the PressWrightCovertheKwa - 11-2005.htm HTML File 12.1 KB Oct 1 2012 3:29 PM
coxreportisarealwhodunit.html HTML File 5.9 KB Oct 1 2012 3:31 PM
Cre88or.ttf TTF File 228 KB Oct 1 2012 3:31 PM
Creamatorium4.pdf PDF Document 70.7 KB Oct 1 2012 3:33 PM
Creaoor - index.html HTML File 2 KB Oct 1 2012 3:29 PM
Creationism and Truth.htm HTML File 4.8 KB Oct 1 2012 3:31 PM
creativity.html HTML File 20.9 KB Oct 1 2012 3:32 PM
Crime Cover-Up in DC.htm HTML File 3.2 KB Oct 1 2012 3:34 PM
CrimeOfOurAge.pdf PDF Document 206.8 KB Oct 1 2012 3:30 PM
Criticism is Not Hate.htm HTML File 9.4 KB Oct 1 2012 3:27 PM
CultureOfCritique.pdf PDF Document 1.9 MB Oct 1 2012 3:28 PM
Curt Maynard - 2006-07-02 - A Frank Discussion of Jewish Group Dynamics.htm HTML File 48.4 KB Oct 1 2012 3:31 PM
Czech Gets Expensive Lesson.htm HTML File 8.6 KB Oct 1 2012 3:28 PM
d2presid.html HTML File 5.2 KB Oct 1 2012 3:30 PM
Daddy_English.pdf PDF Document 413.6 KB Oct 1 2012 3:31 PM
Dallas Cops Nix Katrina Officers.htm HTML File 3.6 KB Oct 1 2012 3:27 PM
Dan Osterton - 2006-07-20 - The Necessity of Invasion.htm HTML File 10.3 KB Oct 1 2012 3:31 PM
dare.pdf PDF Document 348.5 KB Oct 1 2012 3:31 PM
Daryl Bradford Smith - Prepare for the upcoming battle.htm HTML File 20.9 KB Oct 1 2012 3:29 PM
David C Tate - The Cause.pdf PDF Document 166 KB Oct 1 2012 3:32 PM
David Daogherty - 2004-11-12 - The Little-Known World of Pro-White Music.txt Text File 17.1 KB Oct 1 2012 3:30 PM
David Daugherty - 2006-02-09 - Thanks, We Have Our Own Media Now.htm HTML File 16.7 KB Oct 1 2012 3:30 PM
David Duke Discusses Jewish Conspiracy On MSNBC.txt Text File 17.3 KB Oct 1 2012 3:33 PM
David Irving - 1967.pdf PDF Document 937.3 KB Oct 1 2012 3:27 PM
David Irving - Apocalypse.zip ZIP Archive 1.4 MB Oct 1 2012 3:28 PM
David Irving - Generals.zip ZIP Archive 3.5 MB Oct 1 2012 3:30 PM
David Irving - Goebbels.pdf PDF Document 2.9 MB Oct 1 2012 3:33 PM
David Irving - Goering.sit SIT Archive 3.5 MB Oct 1 2012 3:27 PM
David Irving - Hess.zip ZIP Archive 1.8 MB Oct 1 2012 3:31 PM
David Irving - HW1.pdf PDF Document 3.6 MB Oct 1 2012 3:29 PM
David Irving - Keitel.zip ZIP Archive 1 MB Oct 1 2012 3:31 PM
David Irving - MaresNest.zip ZIP Archive 1 MB Oct 1 2012 3:34 PM
David Irving - Milch.zip ZIP Archive 2.1 MB Oct 1 2012 3:32 PM
David Irving - Morell.zip ZIP Archive 880.6 KB Oct 1 2012 3:33 PM
David Irving - Morgenthau_Plan.zip ZIP Archive 215.2 KB Oct 1 2012 3:32 PM
David Irving - NUREMBERG.pdf PDF Document 1.5 MB Oct 1 2012 3:33 PM
David Irving - Pt1.zip ZIP Archive 1.6 MB Oct 1 2012 3:30 PM
David Irving - Pt2.zip ZIP Archive 1.7 MB Oct 1 2012 3:31 PM
David Irving - Pt3.zip ZIP Archive 2.1 MB Oct 1 2012 3:31 PM
David Irving - Pt4.zip ZIP Archive 454.3 KB Oct 1 2012 3:28 PM
David Irving - ReichHoertMit.zip ZIP Archive 1012.9 KB Oct 1 2012 3:31 PM
David Irving - Rommel_illustr.zip ZIP Archive 4.5 MB Oct 1 2012 3:33 PM
David Irving - The Destruction of Convoy PQ. 17 - 1968edition 17 - 1968EDITION File 2.2 MB Oct 1 2012 3:30 PM
David Irving - Uprising.zip ZIP Archive 2 MB Oct 1 2012 3:31 PM
David Irving the 'Anti-Semite'.htm HTML File 5.2 KB Oct 1 2012 3:29 PM
David Lane - 88 Precepts.pdf PDF Document 20.5 KB Oct 1 2012 3:31 PM
David Lane - Dissension in the Ranks.htm HTML File 10.9 KB Oct 1 2012 3:27 PM
David Lane - KD Rebel - 2004.pdf PDF Document 424.8 KB Oct 1 2012 3:30 PM
David Lane - Letter to the Reality Deniers - by David Lane of The Order - P.O.W.txt Text File 14.2 KB Oct 1 2012 3:28 PM
David_Lane - The Final Address of David Lane to the Jury.htm HTML File 5.3 KB Oct 1 2012 3:28 PM
DealingInHate.pdf PDF Document 191.8 KB Oct 1 2012 3:30 PM
Dealing With the Peak Oil Critics.htm HTML File 25.8 KB Oct 1 2012 3:32 PM
Debating the Lobby.htm HTML File 3.1 KB Oct 1 2012 3:33 PM
DebunkingGenocideMyth.pdf PDF Document 771.8 KB Oct 1 2012 3:30 PM
Dec01.pdf PDF Document 1011.5 KB Oct 1 2012 3:27 PM
Dec02.pdf PDF Document 1.3 MB Oct 1 2012 3:28 PM
Dec03.pdf PDF Document 869.2 KB Oct 1 2012 3:31 PM
Dec04.pdf PDF Document 905.8 KB Oct 1 2012 3:28 PM
DeclineOfWest.pdf PDF Document 421.9 KB Oct 1 2012 3:33 PM
Deejay - 'I'm Coming for Your Seed'.htm HTML File 27.8 KB Oct 1 2012 3:31 PM
Deejay’s Appeal - ‘Kill the Whiteness Inside’.htm HTML File 2.1 KB Oct 1 2012 3:31 PM
Defense Firms Making a Killing on Iraq War.htm HTML File 3 KB Oct 1 2012 3:30 PM
Defensible Racism.htm HTML File 11.7 KB Oct 1 2012 3:33 PM
Deir Yassin 1947,.html HTML File 1.3 KB Oct 1 2012 3:29 PM
DemocracyInAmerica.pdf PDF Document 6.7 MB Oct 1 2012 3:28 PM
Democrats Condemn Chertoff's Incompetence.htm HTML File 4 KB Oct 1 2012 3:31 PM
Denver National Vanguard - Supporting the Columbus Day Parade.htm HTML File 4.7 KB Oct 1 2012 3:28 PM
design.pdf PDF Document 173.3 KB Oct 1 2012 3:31 PM
Desperate Jewish News Outlets Abandoning Last Pretenses of Honesty.htm HTML File 2.8 KB Oct 1 2012 3:31 PM
Detainee Paralyzed During Torture in Israeli Prison.htm HTML File 5.1 KB Oct 1 2012 3:31 PM
DetNewsReprint.pdf PDF Document 1.1 MB Oct 1 2012 3:32 PM
Devil's Advocate - The Chinese Have Guts.htm HTML File 7.4 KB Oct 1 2012 3:33 PM
Did Arabs Accidentally Get Canned Pork By Mistake.htm HTML File 3.3 KB Oct 1 2012 3:28 PM
Did Time Magazine Lie to Pad Circulation.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
Disaster Buck Stopped at Chertoff, Not Brown.htm HTML File 3.5 KB Oct 1 2012 3:31 PM
Discussing Race in a Globalized World.htm HTML File 11.5 KB Oct 1 2012 3:33 PM
diversity.pdf PDF Document 503.4 KB Oct 1 2012 3:31 PM
DiversityAtWork.pdf PDF Document 76.3 KB Oct 1 2012 3:28 PM
Diversity Can Only Be Countered With Brutality And War.htm HTML File 46.5 KB Oct 1 2012 3:29 PM
Dividing the World.htm HTML File 22.4 KB Oct 1 2012 3:31 PM
Do Blacks Deserve Billions for Slavery.htm HTML File 11.9 KB Oct 1 2012 3:33 PM
doles.pdf PDF Document 61.2 KB Oct 1 2012 3:33 PM
Do They Think It’s Worth It.htm HTML File 12.6 KB Oct 1 2012 3:33 PM
Doty_H2Price.pdf PDF Document 330.3 KB Oct 1 2012 3:27 PM
Do Whites Really Deserve to Exist.htm HTML File 9.7 KB Oct 1 2012 3:32 PM
downedchinesef8carriedisraelimissile.html HTML File 2 KB Oct 1 2012 3:30 PM
Dr. David Duke - My Awakening - Complete Book from SolarGeneral_com.pdf PDF Document 24.9 MB Oct 1 2012 3:29 PM
Dr. Lorraine Day’s Response to Judy Andreas - zionism.htm HTML File 59.8 KB Oct 1 2012 3:33 PM
Dr. William Pierce - The Turner Diaries.pdf PDF Document 809.7 KB Oct 1 2012 3:29 PM
DR Congo's atrocious secret.htm HTML File 18.8 KB Oct 1 2012 3:27 PM
Dreaming of a Black Christmas.htm HTML File 5.1 KB Oct 1 2012 3:33 PM
Dream of inter-racial cooperation finally a UK reality.htm HTML File 2.6 KB Oct 1 2012 3:31 PM
dresden.pdf PDF Document 974.8 KB Oct 1 2012 3:28 PM
dresden1995.pdf PDF Document 763.7 KB Oct 1 2012 3:31 PM
dropthelist.htm HTML File 21.9 KB Oct 1 2012 3:32 PM
Drug Feud Claims Life of Anti-White Activist.htm HTML File 5.2 KB Oct 1 2012 3:33 PM
dth.pdf PDF Document 16 MB Oct 1 2012 3:28 PM
dth.zip ZIP Archive 6 MB Oct 1 2012 3:30 PM
Dumbing Down America.htm HTML File 4.1 KB Oct 1 2012 3:30 PM
DuneSeries.zip ZIP Archive 7.1 MB Oct 1 2012 3:31 PM
Dutch Inquisition Reborn.htm HTML File 6.7 KB Oct 1 2012 3:34 PM
Dutch to Become First European Nation to Ban Burka.htm HTML File 2.2 KB Oct 1 2012 3:33 PM
Dynohub_assembly.pdf PDF Document 263.7 KB Oct 1 2012 3:28 PM
EBlowback_911.pdf PDF Document 7.7 MB Oct 1 2012 3:31 PM
Ebonics Suggested for District.htm HTML File 2.4 KB Oct 1 2012 3:30 PM
ec.pdf PDF Document 906.4 KB Oct 1 2012 3:32 PM
EcritsRevisionnistes.pdf PDF Document 270.9 KB Oct 1 2012 3:33 PM
EdictOfExpulsion.pdf PDF Document 40.8 KB Oct 1 2012 3:31 PM
Editing Martin Luther King, Jr.htm HTML File 37.4 KB Oct 1 2012 3:31 PM
Educational Sabotage.htm HTML File 35 KB Oct 1 2012 3:31 PM
Educators Baffled at Stubborn Achievement Gap.htm HTML File 12.8 KB Oct 1 2012 3:32 PM
Edward Fagan Sues Lloyd's of London, U.S. Government.htm HTML File 3.4 KB Oct 1 2012 3:31 PM
Edwards.pdf PDF Document 64.2 KB Oct 1 2012 3:31 PM
EFBI_CIA_mob_treachery.pdf PDF Document 2.7 MB Oct 1 2012 3:28 PM
einstein-prioritymyth.htm HTML File 21 KB Oct 1 2012 3:30 PM
EinsteinConspiracy.pdf PDF Document 462.9 KB Oct 1 2012 3:31 PM
EinsteinHoax.pdf PDF Document 3.8 MB Oct 1 2012 3:28 PM
EinsteinStoleE=mc2.htm HTML File 10.1 KB Oct 1 2012 3:31 PM
EIraq_lies.pdf PDF Document 4.1 MB Oct 1 2012 3:32 PM
Eire - YOU DID IT! Now Let's Build On the Success.htm HTML File 4.3 KB Oct 1 2012 3:31 PM
EisenhowersHolocaust.pdf PDF Document 19.8 KB Oct 1 2012 3:27 PM
Elias Lönnrot - The Kalevala - 1888.pdf PDF Document 1 MB Oct 1 2012 3:28 PM
Elizabeth Smith - A Woman Looks at the Lifetime Channel.htm HTML File 10.2 KB Oct 1 2012 3:32 PM
Ellin Anderson - 2005-12-22 - In This Sign.txt Text File 13.8 KB Oct 1 2012 3:31 PM
Empowerment by Rape - the Sexual Holocaust.htm HTML File 13.4 KB Oct 1 2012 3:31 PM
endimmigration.pdf PDF Document 91.3 KB Oct 1 2012 3:33 PM
Ending the Dollar's Tyranny.htm HTML File 19.4 KB Oct 1 2012 3:30 PM
EndKingHolodayNew.pdf PDF Document 109.4 KB Oct 1 2012 3:31 PM
End of an Era - Spearhead to Close.htm HTML File 2.6 KB Oct 1 2012 3:31 PM
End of the Rainbow.htm HTML File 4.9 KB Oct 1 2012 3:32 PM
EndTheKingHoloday.pdf PDF Document 222.5 KB Oct 1 2012 3:31 PM
EnemyOfEurope.pdf PDF Document 545.8 KB Oct 1 2012 3:33 PM
England Prepares to Honor Millenium of First Patron Saint.htm HTML File 4.4 KB Oct 1 2012 3:31 PM
English Lad 'Too Pale'.htm HTML File 2.7 KB Oct 1 2012 3:33 PM
Englishman's Zimbabwean Road Trip to Texas.htm HTML File 2.7 KB Oct 1 2012 3:33 PM
Enron - A Microcosm of America.htm HTML File 5.8 KB Oct 1 2012 3:32 PM
en_gentiles - Gentiles in Halacha.zip ZIP Archive 64.8 KB Oct 1 2012 3:28 PM
en_gentiles1 - Gentiles in Halacha.zip ZIP Archive 8.3 KB Oct 1 2012 3:32 PM
Erik the Norseman A Nation Betrayed.doc Microsoft Word Document 33.5 KB Oct 1 2012 3:32 PM
Erik the Norseman An Essay on Comparative Horror.doc Microsoft Word Document 28 KB Oct 1 2012 3:27 PM
Erik the Norseman Boy Meets Boy - Boy Takes Boy to the Prom.doc Microsoft Word Document 25 KB Oct 1 2012 3:33 PM
Erik the Norseman Canada Diagnosis - CRITICAL.doc Microsoft Word Document 25 KB Oct 1 2012 3:28 PM
Erik the Norseman Canadian Homelessness - A White Problem.doc Microsoft Word Document 30 KB Oct 1 2012 3:28 PM
Erik the Norseman Canadians Can Say What They Want, Eh!.doc Microsoft Word Document 24 KB Oct 1 2012 3:33 PM
Erik the Norseman GOOD MORNING CANADA! Wake Up and Smell the.doc Microsoft Word Document 26.5 KB Oct 1 2012 3:34 PM
Erik the Norseman Iraq Proof Islam is a Nest of Vipers.doc Microsoft Word Document 29.5 KB Oct 1 2012 3:31 PM
Erik the Norseman Just Who Is an Aboriginal.doc Microsoft Word Document 30 KB Oct 1 2012 3:31 PM
Erik the Norseman Loss of Sovereignty to Globalism.doc Microsoft Word Document 28.5 KB Oct 1 2012 3:27 PM
Erik the Norseman Misplaced Hate.doc Microsoft Word Document 26 KB Oct 1 2012 3:31 PM
Erik the Norseman Paul Fromm Speaks in Vancouver Another suc.doc Microsoft Word Document 28 KB Oct 1 2012 3:30 PM
Erik the Norseman Promotion Anyone.doc Microsoft Word Document 26.5 KB Oct 1 2012 3:31 PM
Erik the Norseman Same Rights = Special Rights.doc Microsoft Word Document 28 KB Oct 1 2012 3:28 PM
Erik the Norseman SARS Politically Correct Disease.doc Microsoft Word Document 40 KB Oct 1 2012 3:32 PM
Erik the Norseman Some Dominion Day Reflections on the Benef.doc Microsoft Word Document 29 KB Oct 1 2012 3:31 PM
Erik the Norseman Some Thoughts of a Proud Racialist.doc Microsoft Word Document 33 KB Oct 1 2012 3:30 PM
Erik the Norseman Some Thoughts on Abortion.doc Microsoft Word Document 29.5 KB Oct 1 2012 3:28 PM
Erik the Norseman Some Thoughts on Native Land Claims.doc Microsoft Word Document 33 KB Oct 1 2012 3:28 PM
Erik the Norseman Some Thoughts on Privatization.doc Microsoft Word Document 29 KB Oct 1 2012 3:33 PM
Erik the Norseman Some Thoughts on the Future of Transportat.doc Microsoft Word Document 24.5 KB Oct 1 2012 3:30 PM
Erik the Norseman Some Thoughts on the Judiciary.doc Microsoft Word Document 35.5 KB Oct 1 2012 3:31 PM
Erik the Norseman Some Thoughts on the Prison System.doc Microsoft Word Document 28.5 KB Oct 1 2012 3:34 PM
Erik the Norseman The Paradox of Complimentary Medicine.doc Microsoft Word Document 26 KB Oct 1 2012 3:28 PM
Erik the Norseman The People's Lament.doc Microsoft Word Document 58.5 KB Oct 1 2012 3:30 PM
Erik the Norseman The Zahra Kazemi Debaucle Back in the News.doc Microsoft Word Document 29 KB Oct 1 2012 3:31 PM
Erik the Norseman What Is an Aboriginal.doc Microsoft Word Document 28.5 KB Oct 1 2012 3:28 PM
Erik the Norseman When is a Jew a Jew A call to White Evange.doc Microsoft Word Document 25.5 KB Oct 1 2012 3:33 PM
Erik the Norseman White Pride or White Guilt.doc Microsoft Word Document 39.5 KB Oct 1 2012 3:27 PM
Erik the Norseman Who are the Welfare Bums.doc Microsoft Word Document 26.5 KB Oct 1 2012 3:30 PM
Erik the Norseman Who Built Canada.doc Microsoft Word Document 24.5 KB Oct 1 2012 3:30 PM
essentialphysics1.pdf PDF Document 947.7 KB Oct 1 2012 3:30 PM
Ethiopian Government Begs After Bumper Crop.htm HTML File 2.2 KB Oct 1 2012 3:31 PM
eugenics.htm HTML File 32.9 KB Oct 1 2012 3:29 PM
eugenics.html HTML File 32.9 KB Oct 1 2012 3:31 PM
EugenicsManifesto.pdf PDF Document 346.2 KB Oct 1 2012 3:27 PM
EURO-DNA1.0 & ANCESTRYBYDNA2.5 - USER MANUAL.pdf PDF Document 249.1 KB Oct 1 2012 3:30 PM
Euro 2005 DVD.htm HTML File 2.5 KB Oct 1 2012 3:32 PM
European Origins of Halloween.htm HTML File 6.2 KB Oct 1 2012 3:28 PM
Europeans Having Second Thoughts about Turkey.htm HTML File 6 KB Oct 1 2012 3:31 PM
European Union Applies 'Hate Speech' Rules to Internet.htm HTML File 2.1 KB Oct 1 2012 3:30 PM
Europe’s Successful Moon Probe Mission.htm HTML File 5.7 KB Oct 1 2012 3:28 PM
Euro Slurs and Hate Caricatures.htm HTML File 22.3 KB Oct 1 2012 3:33 PM
euvolution.pdf PDF Document 3.7 MB Oct 1 2012 3:28 PM
Evan Thomas 2005-11-04 - UN to Celebrate Jan. 27 as 'Holocaust Day' 27 AS 'HOLOCAUST DAY' File 5.1 KB Oct 1 2012 3:29 PM
Ex-IRA Soldier Condemns Loss of Traditional Ireland.htm HTML File 3 KB Oct 1 2012 3:28 PM
Ex-Security Chief Blows Whistle on UN's Kosovo Mission.htm HTML File 4.6 KB Oct 1 2012 3:30 PM
Exercise, It’s Not What Your Doctor Prescribed.htm HTML File 3.7 KB Oct 1 2012 3:33 PM
exiles.zip ZIP Archive 129.8 KB Oct 1 2012 3:31 PM
Exodus Remembered_ Passover Inspires Parasite Jewish Concern for Immigrants (But None for Well-Being of Host Nation Citizens).html HTML File 40.8 KB Oct 1 2012 3:28 PM
F95-2.htm HTML File 8.4 KB Oct 1 2012 3:33 PM
Facts.pdf PDF Document 2.7 MB Oct 1 2012 3:33 PM
Facts To Consider Concerning The Holocaust.htm HTML File 120.4 KB Oct 1 2012 3:30 PM
Fading Illusions - D-Day and Reagan.htm HTML File 26.4 KB Oct 1 2012 3:27 PM
Fagan Files $1 Billion 'Holocaust Compensation' Lawsuit.htm HTML File 3.1 KB Oct 1 2012 3:28 PM
FagFacts.pdf PDF Document 194.1 KB Oct 1 2012 3:31 PM
FagFlyer.pdf PDF Document 50.3 KB Oct 1 2012 3:31 PM
failurerateonmathtestup50percentincounty.html HTML File 4.9 KB Oct 1 2012 3:28 PM
Failures of Our Age - Capitalism and Communism.htm HTML File 23.9 KB Oct 1 2012 3:33 PM
fame.css Stylesheet 784 Bytes Oct 1 2012 3:31 PM
fame.pdf PDF Document 2.3 MB Oct 1 2012 3:31 PM
fame.zip ZIP Archive 450.4 KB Oct 1 2012 3:28 PM
famedeadmansdeeds.pdf PDF Document 2.3 MB Oct 1 2012 3:34 PM
Famous people with Scotch Irish blood.htm HTML File 105.3 KB Oct 1 2012 3:32 PM
faq.html HTML File 58.4 KB Oct 1 2012 3:27 PM
faq_francaise.html HTML File 58.7 KB Oct 1 2012 3:33 PM
Farewell to a Good European.htm HTML File 6.3 KB Oct 1 2012 3:31 PM
Fast Times at Regnef High - crying-wolf.htm HTML File 37.1 KB Oct 1 2012 3:33 PM
Fear and Illusion.htm HTML File 3.5 KB Oct 1 2012 3:31 PM
FearAndTrembling.pdf PDF Document 324.8 KB Oct 1 2012 3:32 PM
Feb01.pdf PDF Document 392.4 KB Oct 1 2012 3:28 PM
Feb02.pdf PDF Document 1.7 MB Oct 1 2012 3:29 PM
feb03.pdf PDF Document 1.6 MB Oct 1 2012 3:28 PM
Feb04.pdf PDF Document 1.9 MB Oct 1 2012 3:34 PM
Feds Say Katrina Refugee Gangs a Threat.htm HTML File 3.4 KB Oct 1 2012 3:33 PM
FestumAlbum.doc Microsoft Word Document 540 KB Oct 1 2012 3:27 PM
FEST_FLIER.pdf PDF Document 8.5 KB Oct 1 2012 3:27 PM
Fewer Than 50,000 Whites in Zimbabwe.htm HTML File 3.4 KB Oct 1 2012 3:33 PM
FFNewsF05.pdf PDF Document 668 KB Oct 1 2012 3:30 PM
fhe part1.pdf PDF Document 13.6 MB Oct 1 2012 3:27 PM
fhe part2.pdf PDF Document 9.9 MB Oct 1 2012 3:33 PM
fhe part3.pdf PDF Document 15.4 MB Oct 1 2012 3:31 PM
fhe part4.pdf PDF Document 7.3 MB Oct 1 2012 3:30 PM
fhe part5.pdf PDF Document 5.4 MB Oct 1 2012 3:32 PM
fhe part6.pdf PDF Document 4.7 MB Oct 1 2012 3:29 PM
fhe part7.pdf PDF Document 3.6 MB Oct 1 2012 3:27 PM
fhe part8.pdf PDF Document 4.2 MB Oct 1 2012 3:31 PM
fhe part9.pdf PDF Document 14 MB Oct 1 2012 3:32 PM
fhe part10.pdf PDF Document 9.6 MB Oct 1 2012 3:34 PM
fhe part11.pdf PDF Document 6.9 MB Oct 1 2012 3:33 PM
fhe part12.pdf PDF Document 857.3 KB Oct 1 2012 3:28 PM
Fighting Organized Crime.htm HTML File 26.4 KB Oct 1 2012 3:28 PM
Final Verdict - The false connection between Tim McVeigh and The Turner Diaries.htm HTML File 27.8 KB Oct 1 2012 3:31 PM
Finkelstein Debates Israeli Pol.htm HTML File 15.1 KB Oct 1 2012 3:31 PM
first10years.doc Microsoft Word Document 110 KB Oct 1 2012 3:33 PM
FirstTheyCameForTheArabs.pdf PDF Document 18.7 KB Oct 1 2012 3:30 PM
Five Myths That Sanction Israel's War Crimes.htm HTML File 50.3 KB Oct 1 2012 3:33 PM
FLIER-1.pdf PDF Document 110.9 KB Oct 1 2012 3:27 PM
FLIER-2.pdf PDF Document 46 KB Oct 1 2012 3:32 PM
FLIER-3.pdf PDF Document 51.1 KB Oct 1 2012 3:31 PM
FLIER-4.pdf PDF Document 80.4 KB Oct 1 2012 3:27 PM
FLIER-5.pdf PDF Document 84.7 KB Oct 1 2012 3:30 PM
fliers.html HTML File 43.7 KB Oct 1 2012 3:34 PM
FlorentineChronicle.pdf PDF Document 40.9 KB Oct 1 2012 3:32 PM
Florida - 'King Tut' Prompts Black Protests.htm HTML File 3.9 KB Oct 1 2012 3:34 PM
Florida - Homeowners Association Says 'No' to Evacuees.htm HTML File 3.7 KB Oct 1 2012 3:31 PM
Florida - Vote Ubele.htm HTML File 2.9 KB Oct 1 2012 3:31 PM
Florida School Board Rejects Hall's Resignation.htm HTML File 3.5 KB Oct 1 2012 3:33 PM
FLYER-6.pdf PDF Document 88.1 KB Oct 1 2012 3:27 PM
Flyer.pdf PDF Document 486.8 KB Oct 1 2012 3:33 PM
FOMCalendar.pdf PDF Document 91.7 KB Oct 1 2012 3:31 PM
ForeignersAroundTheWorld.pdf PDF Document 740.5 KB Oct 1 2012 3:34 PM
Foreword to the new edition - Zundel's Story.htm HTML File 31.2 KB Oct 1 2012 3:32 PM
Former Reps. Earl Hilliard (D-Ala.) and Cynthia McKinney (D-Ga.) - Bad for Israel.htm HTML File 4 KB Oct 1 2012 3:29 PM
foundingizzymyths.pdf PDF Document 916.3 KB Oct 1 2012 3:30 PM
foundingizzymyths.rtf RTF File 525.9 KB Oct 1 2012 3:29 PM
France - Another 'Hate Crime' Hoax.htm HTML File 2.7 KB Oct 1 2012 3:30 PM
France - Chirac Calls for Police State to Enforce Multiracialism.htm HTML File 5.4 KB Oct 1 2012 3:28 PM
France - Teacher in Hiding.htm HTML File 3.4 KB Oct 1 2012 3:33 PM
France - Turks Must Admit Genocide.htm HTML File 3 KB Oct 1 2012 3:27 PM
France Lays Dauphin to Rest.htm HTML File 5.2 KB Oct 1 2012 3:30 PM
frankdiaryfraud.pdf PDF Document 111.4 KB Oct 1 2012 3:30 PM
Frank Ellis article (unedited) - 2006-03-27 - Chris Brand comment.txt Text File 24.5 KB Oct 1 2012 3:33 PM
Frankfurt School Aikido.htm HTML File 26.7 KB Oct 1 2012 3:32 PM
FrankLynchedLarge.jpeg JPEG Image 77.5 KB Oct 1 2012 3:33 PM
Frank Roman - 2006-10-07 - Impeach The System.htm HTML File 6.4 KB Oct 1 2012 3:30 PM
freeamericaflyer.pdf PDF Document 127.4 KB Oct 1 2012 3:32 PM
Free Pro-European Music.htm HTML File 2.8 KB Oct 1 2012 3:28 PM
Free Speech Can Be Fatal.htm HTML File 4.9 KB Oct 1 2012 3:31 PM
Free Speech Hypocrisy.htm HTML File 1.9 KB Oct 1 2012 3:32 PM
free_irving.pdf PDF Document 471.4 KB Oct 1 2012 3:31 PM
French culture in vice grip of Muslims both internally and externally.htm HTML File 3.9 KB Oct 1 2012 3:30 PM
Friends of Ulster - USA Scotch Irish _ Ulster Scots.htm HTML File 419.1 KB Oct 1 2012 3:31 PM
FRIPamphlets.pdf PDF Document 727.2 KB Oct 1 2012 3:28 PM
Front National MP Suspended from Teaching Position for Calling for Open Debate.htm HTML File 2.8 KB Oct 1 2012 3:34 PM
fs001a.html HTML File 19.1 KB Oct 1 2012 3:32 PM
fs001b.html HTML File 19.5 KB Oct 1 2012 3:34 PM
fs001c.html HTML File 18.8 KB Oct 1 2012 3:32 PM
fs001d.html HTML File 19.2 KB Oct 1 2012 3:33 PM
fs0010a.html HTML File 19.8 KB Oct 1 2012 3:31 PM
fs0010b.html HTML File 19.5 KB Oct 1 2012 3:31 PM
fs0010c.html HTML File 19.4 KB Oct 1 2012 3:31 PM
fs0010d.html HTML File 20 KB Oct 1 2012 3:28 PM
fs0011a.html HTML File 19.9 KB Oct 1 2012 3:33 PM
fs0011b.html HTML File 20.1 KB Oct 1 2012 3:33 PM
fs0011c.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs0011d.html HTML File 19.6 KB Oct 1 2012 3:31 PM
fs0012a.html HTML File 19.2 KB Oct 1 2012 3:29 PM
fs0012b.html HTML File 20 KB Oct 1 2012 3:32 PM
fs0012c.html HTML File 19.8 KB Oct 1 2012 3:31 PM
fs0012d.html HTML File 19.2 KB Oct 1 2012 3:31 PM
fs002a.html HTML File 19.5 KB Oct 1 2012 3:28 PM
fs002b.html HTML File 19.2 KB Oct 1 2012 3:32 PM
fs002c.html HTML File 19 KB Oct 1 2012 3:27 PM
fs002d.html HTML File 20.5 KB Oct 1 2012 3:33 PM
fs003a.html HTML File 20 KB Oct 1 2012 3:33 PM
fs003b.html HTML File 19.8 KB Oct 1 2012 3:29 PM
fs003c.html HTML File 19.2 KB Oct 1 2012 3:29 PM
fs003d.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs004a.html HTML File 19.5 KB Oct 1 2012 3:29 PM
fs004b.html HTML File 19.2 KB Oct 1 2012 3:31 PM
fs004c.html HTML File 19.2 KB Oct 1 2012 3:31 PM
fs004d.html HTML File 19.8 KB Oct 1 2012 3:33 PM
fs005a.html HTML File 20 KB Oct 1 2012 3:28 PM
fs005b.html HTML File 20 KB Oct 1 2012 3:29 PM
fs005c.html HTML File 20.2 KB Oct 1 2012 3:29 PM
fs005d.html HTML File 19.2 KB Oct 1 2012 3:30 PM
fs006a.html HTML File 20.3 KB Oct 1 2012 3:31 PM
fs006b.html HTML File 19.7 KB Oct 1 2012 3:30 PM
fs006c.html HTML File 19.7 KB Oct 1 2012 3:29 PM
fs006d.html HTML File 19.7 KB Oct 1 2012 3:28 PM
fs007a.html HTML File 20 KB Oct 1 2012 3:31 PM
fs007b.html HTML File 19.6 KB Oct 1 2012 3:31 PM
fs007c.html HTML File 20.3 KB Oct 1 2012 3:29 PM
fs007d.html HTML File 20 KB Oct 1 2012 3:33 PM
fs008a.html HTML File 19.4 KB Oct 1 2012 3:31 PM
fs008b.html HTML File 19.8 KB Oct 1 2012 3:28 PM
fs008c.html HTML File 19.9 KB Oct 1 2012 3:31 PM
fs008d.html HTML File 20.4 KB Oct 1 2012 3:33 PM
fs009a.html HTML File 19.9 KB Oct 1 2012 3:33 PM
fs009b.html HTML File 19.1 KB Oct 1 2012 3:32 PM
fs009c.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs009d.html HTML File 19.4 KB Oct 1 2012 3:33 PM
fs0101a.html HTML File 20 KB Oct 1 2012 3:33 PM
fs0101b.html HTML File 20.2 KB Oct 1 2012 3:28 PM
fs0101c.html HTML File 20.4 KB Oct 1 2012 3:31 PM
fs0101d.html HTML File 20.4 KB Oct 1 2012 3:33 PM
fs0102a.html HTML File 19.7 KB Oct 1 2012 3:33 PM
fs0102b.html HTML File 20.3 KB Oct 1 2012 3:30 PM
fs0102c.html HTML File 19.1 KB Oct 1 2012 3:28 PM
fs0102d.html HTML File 19.8 KB Oct 1 2012 3:32 PM
fs0103a.html HTML File 20.3 KB Oct 1 2012 3:31 PM
fs0103b.html HTML File 20 KB Oct 1 2012 3:30 PM
fs0103c.html HTML File 20.1 KB Oct 1 2012 3:33 PM
fs0103d.html HTML File 20.4 KB Oct 1 2012 3:28 PM
fs0104a.html HTML File 20.1 KB Oct 1 2012 3:31 PM
fs0104b.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs0104c.html HTML File 19.8 KB Oct 1 2012 3:27 PM
fs0104d.html HTML File 20.2 KB Oct 1 2012 3:31 PM
fs0105a.html HTML File 19.5 KB Oct 1 2012 3:28 PM
fs0105b.html HTML File 20.1 KB Oct 1 2012 3:28 PM
fs0105c.html HTML File 19.9 KB Oct 1 2012 3:31 PM
fs0105d.html HTML File 19.1 KB Oct 1 2012 3:33 PM
fs0106a.html HTML File 19.1 KB Oct 1 2012 3:31 PM
fs0106b.html HTML File 19.9 KB Oct 1 2012 3:28 PM
fs0106c.html HTML File 18.5 KB Oct 1 2012 3:30 PM
fs0106d.html HTML File 20.2 KB Oct 1 2012 3:34 PM
fs0107a.html HTML File 19.8 KB Oct 1 2012 3:28 PM
fs0107b.html HTML File 19.7 KB Oct 1 2012 3:32 PM
fs0107c.html HTML File 20.1 KB Oct 1 2012 3:27 PM
fs0107d.html HTML File 20.2 KB Oct 1 2012 3:31 PM
fs0108a.html HTML File 19.9 KB Oct 1 2012 3:32 PM
fs0108b.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs0108c.html HTML File 20.1 KB Oct 1 2012 3:30 PM
fs0108d.html HTML File 19.2 KB Oct 1 2012 3:31 PM
fs0109a.html HTML File 20.1 KB Oct 1 2012 3:33 PM
fs0109b.html HTML File 20.4 KB Oct 1 2012 3:31 PM
fs0109c.html HTML File 20.3 KB Oct 1 2012 3:30 PM
fs0109d.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs0110a.html HTML File 20.4 KB Oct 1 2012 3:28 PM
fs0110b.html HTML File 21.9 KB Oct 1 2012 3:34 PM
fs0110c.html HTML File 20.5 KB Oct 1 2012 3:31 PM
fs0110d.html HTML File 20.2 KB Oct 1 2012 3:33 PM
fs0111a.html HTML File 20.7 KB Oct 1 2012 3:28 PM
fs0111b.html HTML File 20.1 KB Oct 1 2012 3:28 PM
fs0111c.html HTML File 20.5 KB Oct 1 2012 3:33 PM
fs0111d.html HTML File 21.2 KB Oct 1 2012 3:31 PM
fs0112a.html HTML File 19.2 KB Oct 1 2012 3:31 PM
fs0112b.html HTML File 20 KB Oct 1 2012 3:28 PM
fs0112c.html HTML File 20.2 KB Oct 1 2012 3:27 PM
fs0112d.html HTML File 20.4 KB Oct 1 2012 3:31 PM
FS02-10.pdf PDF Document 1.1 MB Oct 1 2012 3:30 PM
fs0201a.html HTML File 20.2 KB Oct 1 2012 3:33 PM
fs0201b.html HTML File 19.8 KB Oct 1 2012 3:33 PM
fs0201c.html HTML File 20 KB Oct 1 2012 3:30 PM
fs0201d.html HTML File 19.9 KB Oct 1 2012 3:32 PM
fs0202a.html HTML File 19.7 KB Oct 1 2012 3:29 PM
fs0202b.html HTML File 20.2 KB Oct 1 2012 3:29 PM
fs0202c.html HTML File 20.2 KB Oct 1 2012 3:34 PM
fs0202d.html HTML File 20.6 KB Oct 1 2012 3:32 PM
fs0203a.html HTML File 20.2 KB Oct 1 2012 3:30 PM
fs0203b.html HTML File 20 KB Oct 1 2012 3:32 PM
fs0203c.html HTML File 19.3 KB Oct 1 2012 3:33 PM
fs0203d.html HTML File 20.1 KB Oct 1 2012 3:27 PM
fs0204a.html HTML File 20.3 KB Oct 1 2012 3:34 PM
fs0204b.html HTML File 19.4 KB Oct 1 2012 3:28 PM
fs0204c.html HTML File 20.3 KB Oct 1 2012 3:34 PM
fs0204d.html HTML File 20.2 KB Oct 1 2012 3:28 PM
fs0205a.html HTML File 19.5 KB Oct 1 2012 3:32 PM
fs0205b.html HTML File 19.9 KB Oct 1 2012 3:31 PM
fs0205c.html HTML File 19.3 KB Oct 1 2012 3:29 PM
fs0205d.html HTML File 20.5 KB Oct 1 2012 3:31 PM
fs0206a.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs0206b.html HTML File 19.7 KB Oct 1 2012 3:28 PM
fs0206c.html HTML File 20.1 KB Oct 1 2012 3:33 PM
fs0206d.html HTML File 19.7 KB Oct 1 2012 3:34 PM
fs0207a.html HTML File 20.3 KB Oct 1 2012 3:29 PM
fs0207b.html HTML File 19.4 KB Oct 1 2012 3:31 PM
fs0207c.html HTML File 19.7 KB Oct 1 2012 3:27 PM
fs0207d.html HTML File 20.2 KB Oct 1 2012 3:29 PM
fs0208a.html HTML File 20.2 KB Oct 1 2012 3:33 PM
fs0208b.html HTML File 19.5 KB Oct 1 2012 3:27 PM
fs0208c.html HTML File 39.1 KB Oct 1 2012 3:28 PM
fs0209a.html HTML File 15.8 KB Oct 1 2012 3:32 PM
fs0209b.html HTML File 21.8 KB Oct 1 2012 3:28 PM
fs0209c.html HTML File 19.1 KB Oct 1 2012 3:33 PM
fs0209d.html HTML File 20.4 KB Oct 1 2012 3:27 PM
fs951a.html HTML File 19.7 KB Oct 1 2012 3:30 PM
fs951b.html HTML File 18.5 KB Oct 1 2012 3:31 PM
fs951c.html HTML File 20 KB Oct 1 2012 3:32 PM
fs951d.html HTML File 9 KB Oct 1 2012 3:28 PM
fs952a.html HTML File 18.3 KB Oct 1 2012 3:33 PM
fs952b.html HTML File 8.4 KB Oct 1 2012 3:31 PM
fs952c.html HTML File 10.4 KB Oct 1 2012 3:32 PM
fs952d.html HTML File 6.7 KB Oct 1 2012 3:33 PM
fs952e.html HTML File 17 KB Oct 1 2012 3:31 PM
fs953a.html HTML File 9.5 KB Oct 1 2012 3:33 PM
fs953b.html HTML File 6.8 KB Oct 1 2012 3:31 PM
fs953c.html HTML File 18.6 KB Oct 1 2012 3:33 PM
fs953d.html HTML File 12.9 KB Oct 1 2012 3:34 PM
fs953e.html HTML File 15.6 KB Oct 1 2012 3:34 PM
fs954a.html HTML File 17.9 KB Oct 1 2012 3:34 PM
fs954b.html HTML File 33 KB Oct 1 2012 3:32 PM
fs954c.html HTML File 18.5 KB Oct 1 2012 3:31 PM
fs955a.html HTML File 18 KB Oct 1 2012 3:31 PM
fs955b.html HTML File 20.2 KB Oct 1 2012 3:34 PM
fs955c.html HTML File 18.7 KB Oct 1 2012 3:29 PM
fs955d.html HTML File 20.3 KB Oct 1 2012 3:34 PM
fs956a.html HTML File 37.8 KB Oct 1 2012 3:33 PM
fs956b.html HTML File 31.2 KB Oct 1 2012 3:33 PM
fs957a.html HTML File 16.8 KB Oct 1 2012 3:29 PM
fs957b.html HTML File 16.9 KB Oct 1 2012 3:33 PM
fs957c.html HTML File 9.2 KB Oct 1 2012 3:33 PM
fs957d.html HTML File 5.3 KB Oct 1 2012 3:31 PM
fs957e.html HTML File 8.1 KB Oct 1 2012 3:28 PM
fs958a.html HTML File 22.3 KB Oct 1 2012 3:34 PM
fs958d.html HTML File 18.1 KB Oct 1 2012 3:32 PM
fs958e.html HTML File 18.5 KB Oct 1 2012 3:32 PM
fs958f.html HTML File 7.1 KB Oct 1 2012 3:31 PM
fs959a.html HTML File 19 KB Oct 1 2012 3:32 PM
fs959b.html HTML File 4.7 KB Oct 1 2012 3:28 PM
fs959c.html HTML File 16.1 KB Oct 1 2012 3:30 PM
fs959d.html HTML File 14.9 KB Oct 1 2012 3:29 PM
fs961a.html HTML File 19 KB Oct 1 2012 3:33 PM
fs961b.html HTML File 18.5 KB Oct 1 2012 3:32 PM
fs961c.html HTML File 16.3 KB Oct 1 2012 3:34 PM
fs961d.html HTML File 20.6 KB Oct 1 2012 3:32 PM
fs962a.html HTML File 17.4 KB Oct 1 2012 3:28 PM
fs962b.html HTML File 19 KB Oct 1 2012 3:28 PM
fs962c.html HTML File 3.5 KB Oct 1 2012 3:28 PM
fs962d.html HTML File 16.8 KB Oct 1 2012 3:28 PM
fs962e.html HTML File 19.3 KB Oct 1 2012 3:29 PM
fs963a.html HTML File 18.3 KB Oct 1 2012 3:27 PM
fs963b.html HTML File 4.2 KB Oct 1 2012 3:33 PM
fs963c.html HTML File 14.3 KB Oct 1 2012 3:31 PM
fs963d.html HTML File 19.1 KB Oct 1 2012 3:28 PM
fs964a.html HTML File 22.4 KB Oct 1 2012 3:34 PM
fs964b.html HTML File 19.3 KB Oct 1 2012 3:28 PM
fs964c.html HTML File 3.1 KB Oct 1 2012 3:32 PM
fs964d.html HTML File 19.2 KB Oct 1 2012 3:31 PM
fs964e.html HTML File 18.3 KB Oct 1 2012 3:34 PM
fs965a.html HTML File 19.3 KB Oct 1 2012 3:29 PM
fs965b.html HTML File 15.1 KB Oct 1 2012 3:28 PM
fs965c.html HTML File 19.1 KB Oct 1 2012 3:31 PM
fs965d.html HTML File 16.3 KB Oct 1 2012 3:29 PM
fs965e.html HTML File 2.2 KB Oct 1 2012 3:30 PM
fs966a.html HTML File 15.7 KB Oct 1 2012 3:32 PM
fs966b.html HTML File 19.7 KB Oct 1 2012 3:28 PM
fs966c.html HTML File 15.9 KB Oct 1 2012 3:31 PM
fs966d.html HTML File 18.6 KB Oct 1 2012 3:29 PM
fs967a.html HTML File 20.5 KB Oct 1 2012 3:32 PM
fs967b.html HTML File 3.7 KB Oct 1 2012 3:31 PM
fs967c.html HTML File 18.9 KB Oct 1 2012 3:31 PM
fs967d.html HTML File 8.8 KB Oct 1 2012 3:33 PM
fs967e.html HTML File 18.8 KB Oct 1 2012 3:28 PM
fs967f.html HTML File 18.6 KB Oct 1 2012 3:31 PM
fs968a.html HTML File 17.7 KB Oct 1 2012 3:33 PM
fs968b.html HTML File 16.4 KB Oct 1 2012 3:27 PM
fs968c.html HTML File 19.1 KB Oct 1 2012 3:34 PM
fs968d.html HTML File 18 KB Oct 1 2012 3:33 PM
fs969a.html HTML File 17.1 KB Oct 1 2012 3:29 PM
fs969b.html HTML File 18.8 KB Oct 1 2012 3:32 PM
fs969c.html HTML File 19.9 KB Oct 1 2012 3:28 PM
fs969d.html HTML File 18.6 KB Oct 1 2012 3:28 PM
fs971a.html HTML File 17.7 KB Oct 1 2012 3:30 PM
fs971b.html HTML File 29.3 KB Oct 1 2012 3:29 PM
fs971c.html HTML File 17.3 KB Oct 1 2012 3:34 PM
fs972a.html HTML File 17.3 KB Oct 1 2012 3:32 PM
fs972b.html HTML File 17.1 KB Oct 1 2012 3:29 PM
fs972c.html HTML File 17.3 KB Oct 1 2012 3:31 PM
fs972d.html HTML File 17.7 KB Oct 1 2012 3:31 PM
fs973a.html HTML File 17.6 KB Oct 1 2012 3:30 PM
fs973b.html HTML File 18.5 KB Oct 1 2012 3:28 PM
fs973c.html HTML File 18.6 KB Oct 1 2012 3:29 PM
fs973d.html HTML File 15.8 KB Oct 1 2012 3:32 PM
fs974a.html HTML File 17.3 KB Oct 1 2012 3:31 PM
fs974b.html HTML File 17.2 KB Oct 1 2012 3:34 PM
fs974c.html HTML File 17.2 KB Oct 1 2012 3:32 PM
fs974d.html HTML File 17.8 KB Oct 1 2012 3:31 PM
fs975a.html HTML File 17.7 KB Oct 1 2012 3:31 PM
fs975b.html HTML File 18 KB Oct 1 2012 3:32 PM
fs975c.html HTML File 18.6 KB Oct 1 2012 3:27 PM
fs975d.html HTML File 17.6 KB Oct 1 2012 3:33 PM
fs976a.html HTML File 17.4 KB Oct 1 2012 3:30 PM
fs976b.html HTML File 17.2 KB Oct 1 2012 3:31 PM
fs976c.html HTML File 17 KB Oct 1 2012 3:27 PM
fs976d.html HTML File 17.7 KB Oct 1 2012 3:31 PM
fs977a.html HTML File 17.9 KB Oct 1 2012 3:32 PM
fs977b.html HTML File 17.6 KB Oct 1 2012 3:33 PM
fs977c.html HTML File 18.1 KB Oct 1 2012 3:28 PM
fs977d.html HTML File 17.5 KB Oct 1 2012 3:28 PM
fs978a.html HTML File 17.5 KB Oct 1 2012 3:31 PM
fs978b.html HTML File 17.1 KB Oct 1 2012 3:31 PM
fs978c.html HTML File 17.1 KB Oct 1 2012 3:33 PM
fs978d.html HTML File 17 KB Oct 1 2012 3:33 PM
fs979a.html HTML File 17.3 KB Oct 1 2012 3:34 PM
fs979b.html HTML File 18 KB Oct 1 2012 3:32 PM
fs979c.html HTML File 17.4 KB Oct 1 2012 3:28 PM
fs979d.html HTML File 17.4 KB Oct 1 2012 3:33 PM
fs981a.html HTML File 16.9 KB Oct 1 2012 3:31 PM
fs981b.html HTML File 16.7 KB Oct 1 2012 3:31 PM
fs981c.html HTML File 17.2 KB Oct 1 2012 3:32 PM
fs981d.html HTML File 17.9 KB Oct 1 2012 3:31 PM
fs982a.html HTML File 18.2 KB Oct 1 2012 3:34 PM
fs982b.html HTML File 17.8 KB Oct 1 2012 3:32 PM
fs982c.html HTML File 17.1 KB Oct 1 2012 3:33 PM
fs982d.html HTML File 16.8 KB Oct 1 2012 3:29 PM
fs983a.html HTML File 16.3 KB Oct 1 2012 3:32 PM
fs983b.html HTML File 18.3 KB Oct 1 2012 3:31 PM
fs983c.html HTML File 18.1 KB Oct 1 2012 3:33 PM
fs983d.html HTML File 17.4 KB Oct 1 2012 3:32 PM
fs984a.html HTML File 17.1 KB Oct 1 2012 3:31 PM
fs984b.html HTML File 17.5 KB Oct 1 2012 3:29 PM
fs984c.html HTML File 18.4 KB Oct 1 2012 3:31 PM
fs984d.html HTML File 17 KB Oct 1 2012 3:30 PM
fs985a.html HTML File 18.4 KB Oct 1 2012 3:31 PM
fs985b.html HTML File 18 KB Oct 1 2012 3:28 PM
fs985c.html HTML File 17.4 KB Oct 1 2012 3:33 PM
fs985d.html HTML File 17.2 KB Oct 1 2012 3:29 PM
fs986a.html HTML File 18.3 KB Oct 1 2012 3:34 PM
fs986b.html HTML File 18.2 KB Oct 1 2012 3:28 PM
fs986c.html HTML File 16.8 KB Oct 1 2012 3:33 PM
fs986d.html HTML File 18.5 KB Oct 1 2012 3:32 PM
fs987a.html HTML File 18.4 KB Oct 1 2012 3:30 PM
fs987b.html HTML File 17.1 KB Oct 1 2012 3:31 PM
fs987c.html HTML File 18.9 KB Oct 1 2012 3:30 PM
fs987d.html HTML File 18.8 KB Oct 1 2012 3:33 PM
fs988a.html HTML File 17.7 KB Oct 1 2012 3:32 PM
fs988b.html HTML File 17.1 KB Oct 1 2012 3:27 PM
fs988c.html HTML File 17.7 KB Oct 1 2012 3:31 PM
fs988d.html HTML File 19.3 KB Oct 1 2012 3:31 PM
fs989a.html HTML File 18.5 KB Oct 1 2012 3:27 PM
fs989b.html HTML File 18.8 KB Oct 1 2012 3:28 PM
fs989c.html HTML File 20 KB Oct 1 2012 3:28 PM
fs989d.html HTML File 19.8 KB Oct 1 2012 3:30 PM
fs991a.html HTML File 20.2 KB Oct 1 2012 3:29 PM
fs991b.html HTML File 19.1 KB Oct 1 2012 3:31 PM
fs991c.html HTML File 20.3 KB Oct 1 2012 3:27 PM
fs991d.html HTML File 19.9 KB Oct 1 2012 3:29 PM
fs992a.html HTML File 20.4 KB Oct 1 2012 3:31 PM
fs992b.html HTML File 20.3 KB Oct 1 2012 3:32 PM
fs992c.html HTML File 19.8 KB Oct 1 2012 3:28 PM
fs992d.html HTML File 19.9 KB Oct 1 2012 3:32 PM
fs993a.html HTML File 19.7 KB Oct 1 2012 3:29 PM
fs993b.html HTML File 19.4 KB Oct 1 2012 3:28 PM
fs993c.html HTML File 20.3 KB Oct 1 2012 3:34 PM
fs993d.html HTML File 20 KB Oct 1 2012 3:33 PM
fs994a.html HTML File 20 KB Oct 1 2012 3:32 PM
fs994b.html HTML File 19.6 KB Oct 1 2012 3:31 PM
fs994c.html HTML File 19.8 KB Oct 1 2012 3:31 PM
fs994d.html HTML File 19.5 KB Oct 1 2012 3:31 PM
fs995a.html HTML File 19.5 KB Oct 1 2012 3:27 PM
fs995b.html HTML File 20.1 KB Oct 1 2012 3:34 PM
fs995c.html HTML File 19.5 KB Oct 1 2012 3:31 PM
fs995d.html HTML File 19.1 KB Oct 1 2012 3:31 PM
fs996a.html HTML File 19.6 KB Oct 1 2012 3:32 PM
fs996b.html HTML File 19.3 KB Oct 1 2012 3:33 PM
fs996c.html HTML File 19.8 KB Oct 1 2012 3:32 PM
fs996d.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs997a.html HTML File 19.9 KB Oct 1 2012 3:28 PM
fs997b.html HTML File 20 KB Oct 1 2012 3:30 PM
fs997c.html HTML File 19.7 KB Oct 1 2012 3:30 PM
fs997d.html HTML File 19.8 KB Oct 1 2012 3:32 PM
fs998a.html HTML File 19.7 KB Oct 1 2012 3:31 PM
fs998b.html HTML File 19.8 KB Oct 1 2012 3:31 PM
fs998c.html HTML File 20 KB Oct 1 2012 3:32 PM
fs998d.html HTML File 19.7 KB Oct 1 2012 3:30 PM
fs999a.html HTML File 19.7 KB Oct 1 2012 3:30 PM
fs999b.html HTML File 19.4 KB Oct 1 2012 3:29 PM
fs999c.html HTML File 20 KB Oct 1 2012 3:33 PM
fs999d.html HTML File 20.1 KB Oct 1 2012 3:30 PM
fs9510a.html HTML File 18.5 KB Oct 1 2012 3:33 PM
fs9510b.html HTML File 18.3 KB Oct 1 2012 3:27 PM
fs9511a.html HTML File 18.6 KB Oct 1 2012 3:34 PM
fs9511c.html HTML File 55.8 KB Oct 1 2012 3:31 PM
fs9511d.html HTML File 18.9 KB Oct 1 2012 3:28 PM
fs9512a.html HTML File 17.9 KB Oct 1 2012 3:33 PM
fs9512b.html HTML File 12.6 KB Oct 1 2012 3:31 PM
fs9512c.html HTML File 7.9 KB Oct 1 2012 3:33 PM
fs9512d.html HTML File 16.4 KB Oct 1 2012 3:34 PM
fs9611a.html HTML File 13.2 KB Oct 1 2012 3:31 PM
fs9611b.html HTML File 18.6 KB Oct 1 2012 3:29 PM
fs9611c.html HTML File 18.4 KB Oct 1 2012 3:27 PM
fs9611d.html HTML File 13.8 KB Oct 1 2012 3:31 PM
fs9612a.html HTML File 61.9 KB Oct 1 2012 3:28 PM
fs9710a.html HTML File 16.7 KB Oct 1 2012 3:30 PM
fs9710b.html HTML File 17.1 KB Oct 1 2012 3:27 PM
fs9710c.html HTML File 17.7 KB Oct 1 2012 3:32 PM
fs9710d.html HTML File 16.4 KB Oct 1 2012 3:30 PM
fs9711a.html HTML File 17.8 KB Oct 1 2012 3:31 PM
fs9711b.html HTML File 18.3 KB Oct 1 2012 3:28 PM
fs9711c.html HTML File 17.2 KB Oct 1 2012 3:30 PM
fs9711d.html HTML File 17.6 KB Oct 1 2012 3:31 PM
fs9712a.html HTML File 18 KB Oct 1 2012 3:31 PM
fs9712b.html HTML File 17.3 KB Oct 1 2012 3:32 PM
fs9712c.html HTML File 17.4 KB Oct 1 2012 3:28 PM
fs9712d.html HTML File 18 KB Oct 1 2012 3:28 PM
fs9810a.html HTML File 19.7 KB Oct 1 2012 3:32 PM
fs9810b.html HTML File 20 KB Oct 1 2012 3:31 PM
fs9810c.html HTML File 20.3 KB Oct 1 2012 3:31 PM
fs9810d.html HTML File 20 KB Oct 1 2012 3:33 PM
fs9811a.html HTML File 19.9 KB Oct 1 2012 3:31 PM
fs9811b.html HTML File 20.3 KB Oct 1 2012 3:27 PM
fs9811c.html HTML File 19.9 KB Oct 1 2012 3:29 PM
fs9811d.html HTML File 19.6 KB Oct 1 2012 3:31 PM
fs9812a.html HTML File 19.9 KB Oct 1 2012 3:31 PM
fs9812b.html HTML File 19.9 KB Oct 1 2012 3:28 PM
fs9812c.html HTML File 19.9 KB Oct 1 2012 3:33 PM
fs9812d.html HTML File 19.6 KB Oct 1 2012 3:33 PM
fs9910a.html HTML File 19.9 KB Oct 1 2012 3:31 PM
fs9910b.html HTML File 20.2 KB Oct 1 2012 3:30 PM
fs9910c.html HTML File 20.1 KB Oct 1 2012 3:30 PM
fs9910d.html HTML File 19.8 KB Oct 1 2012 3:27 PM
fs9911a.html HTML File 19.9 KB Oct 1 2012 3:31 PM
fs9911b.html HTML File 19.2 KB Oct 1 2012 3:27 PM
fs9911c.html HTML File 19.9 KB Oct 1 2012 3:29 PM
fs9911d.html HTML File 20.2 KB Oct 1 2012 3:31 PM
fs9912a.html HTML File 20 KB Oct 1 2012 3:31 PM
fs9912b.html HTML File 20.1 KB Oct 1 2012 3:27 PM
fs9912c.html HTML File 19 KB Oct 1 2012 3:31 PM
fs9912d.html HTML File 19.3 KB Oct 1 2012 3:33 PM
Full Text of Ahmadinejad's Letter to Merkel.htm HTML File 19.3 KB Oct 1 2012 3:28 PM
futureofman.pdf PDF Document 1.5 MB Oct 1 2012 3:27 PM
ga-1-73.pdf PDF Document 16.3 MB Oct 1 2012 3:31 PM
galileeflowers.pdf PDF Document 2.3 MB Oct 1 2012 3:33 PM
galileeflowers.rtf RTF File 1.1 MB Oct 1 2012 3:28 PM
GasChamberExecution.pdf PDF Document 39.9 KB Oct 1 2012 3:33 PM
gas_prices.pdf PDF Document 164.6 KB Oct 1 2012 3:33 PM
Genes Trace the Ancient Wanderings of White People.htm HTML File 7.8 KB Oct 1 2012 3:31 PM
Genetic Branching - Keep it Going.htm HTML File 13.4 KB Oct 1 2012 3:29 PM
George Orwell - 1984.pdf PDF Document 564.4 KB Oct 1 2012 3:31 PM
GermanLawAndLegislation.pdf PDF Document 64.6 KB Oct 1 2012 3:34 PM
GermanLawAndLegislation.rtf RTF File 88.2 KB Oct 1 2012 3:27 PM
German Politicians Talk Turkey.htm HTML File 2.6 KB Oct 1 2012 3:32 PM
Germany - PC Gift to Patriots.htm HTML File 2.9 KB Oct 1 2012 3:33 PM
getreadyforthecomingconflictwithchina.html HTML File 6 KB Oct 1 2012 3:33 PM
GFactor.pdf PDF Document 722.2 KB Oct 1 2012 3:32 PM
Giant.pdf PDF Document 1.4 MB Oct 1 2012 3:31 PM
gibson.pdf PDF Document 591.9 KB Oct 1 2012 3:28 PM
gibson_wm_docs_072806.pdf PDF Document 248.1 KB Oct 1 2012 3:31 PM
Give Them Lead, Not Silver.htm HTML File 3 KB Oct 1 2012 3:33 PM
God, Religion, and Tribal Conflict.htm HTML File 30.2 KB Oct 1 2012 3:28 PM
Goebbels.pdf PDF Document 2.9 MB Oct 1 2012 3:31 PM
Goering.pdf PDF Document 3.8 MB Oct 1 2012 3:31 PM
good_jewbad_jew_paradigm - The Mindset that Impedes Civilization's Healing Process.htm HTML File 26.1 KB Oct 1 2012 3:31 PM
Governor Schwarzenegger's Statement Denying Tookie Clemency.htm HTML File 12.4 KB Oct 1 2012 3:30 PM
grafmemoir.pdf PDF Document 153.1 KB Oct 1 2012 3:28 PM
grafmemoir.rtf RTF File 194.8 KB Oct 1 2012 3:29 PM
Gramage's DVD copying guide - v2 .rtf RTF File 16.3 KB Oct 1 2012 3:34 PM
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust.htm HTML File 13.4 KB Oct 1 2012 3:32 PM
Greg Kay - 2004-11-24 - Empowerment by Rape - The Sexual Holocaust.txt Text File 11.7 KB Oct 1 2012 3:34 PM
Guazzo.html HTML File 10 KB Oct 1 2012 3:28 PM
Guilt March Hosts Named For Plagiarist.htm HTML File 5.8 KB Oct 1 2012 3:27 PM
guilty.pdf PDF Document 55.4 KB Oct 1 2012 3:28 PM
gulag.html HTML File 3.1 KB Oct 1 2012 3:32 PM
Guts - A White Man Who Won't Back Down.htm HTML File 4.3 KB Oct 1 2012 3:32 PM
Guy Ritchie - Kabbalah Ruined My Film.htm HTML File 4.1 KB Oct 1 2012 3:30 PM
H067172052X.zip ZIP Archive 398.5 KB Oct 1 2012 3:28 PM
Half of Katrina Refugees Are Criminals.htm HTML File 3.6 KB Oct 1 2012 3:29 PM
halfofprisonersareblack.html HTML File 4.6 KB Oct 1 2012 3:31 PM
hans.pdf PDF Document 62.6 KB Oct 1 2012 3:33 PM
Hans Christian Andersen (1845) - Holger Danske.htm HTML File 11.4 KB Oct 1 2012 3:29 PM
Happy German-American Day.htm HTML File 3.4 KB Oct 1 2012 3:29 PM
Harold A. Covington - A Distant Thunder.doc Microsoft Word Document 1.3 MB Oct 1 2012 3:34 PM
Has King Tut Been 'Whitewashed'.htm HTML File 2.5 KB Oct 1 2012 3:27 PM
hate crime.pdf PDF Document 408.8 KB Oct 1 2012 3:33 PM
hatecrimespamphlet.pdf PDF Document 62.2 KB Oct 1 2012 3:30 PM
hatedir.pdf PDF Document 1 MB Oct 1 2012 3:31 PM
hate directory.pdf PDF Document 392.4 KB Oct 1 2012 3:31 PM
Head of Homeland Security Has Ties With Suspected Financier of 911.htm HTML File 2 KB Oct 1 2012 3:31 PM
Heather Mac Donald on Immigration on National Review Online - A Latin conservative tidal wave is not coming.htm HTML File 8 KB Oct 1 2012 3:33 PM
he Jewish Conquest of the World.htm HTML File 71.3 KB Oct 1 2012 3:30 PM
Henry David Thoreau - Civil Disobedience.pdf PDF Document 87.8 KB Oct 1 2012 3:28 PM
Henry Ford - 1922-01-07 - Candid Address to Jews on the Jewish Problem.htm HTML File 29.3 KB Oct 1 2012 3:30 PM
Henry Kissinger - The Walking, Talking Conflict of Interest.htm HTML File 22.4 KB Oct 1 2012 3:33 PM
Hess.pdf PDF Document 2.1 MB Oct 1 2012 3:31 PM
hey're Not All Bad...Are They.htm HTML File 9.6 KB Oct 1 2012 3:28 PM
hey_you.pdf PDF Document 121 KB Oct 1 2012 3:31 PM
Hezbollah Broke Israeli Codes.htm HTML File 3.2 KB Oct 1 2012 3:34 PM
hidden.html HTML File 12.7 KB Oct 1 2012 3:31 PM
HighCostOfVengeance.pdf PDF Document 212.3 KB Oct 1 2012 3:33 PM
High School Failure Rate Highest in Non-White Districts.htm HTML File 3.3 KB Oct 1 2012 3:28 PM
Hilarious PC Language Lesson.htm HTML File 4 KB Oct 1 2012 3:28 PM
HILLARY, TORRICELLI DONOR'S FUNNY MONEY Port's New Head, Sued by Brother, Faces an Inquiry.htm HTML File 62 KB Oct 1 2012 3:31 PM
Himmelfarb.pdf PDF Document 122.3 KB Oct 1 2012 3:32 PM
HispanicsReport.pdf PDF Document 985.5 KB Oct 1 2012 3:29 PM
Historical Myth Justifies Golan Heights Occupation.htm HTML File 5.5 KB Oct 1 2012 3:28 PM
history.html HTML File 51 KB Oct 1 2012 3:33 PM
History of the Original Ku Klux Klan.txt Text File 47.1 KB Oct 1 2012 3:31 PM
histwiz 1.pdf PDF Document 8.7 MB Oct 1 2012 3:34 PM
histwiz 2.pdf PDF Document 1.8 MB Oct 1 2012 3:28 PM
histwiz 3.pdf PDF Document 1.7 MB Oct 1 2012 3:33 PM
histwiz 4.pdf PDF Document 159.3 KB Oct 1 2012 3:29 PM
HitlerLifeOfALeader.pdf PDF Document 6.1 MB Oct 1 2012 3:31 PM
HitlerWeLovedAndWhy.rtf RTF File 88.6 KB Oct 1 2012 3:31 PM
H Millard - Homeless Jack on Iran, Freedom, Intellectuals, and the Holocaust.htm HTML File 12.7 KB Oct 1 2012 3:31 PM
Hmong Immigrant Commits Mass Murder in Northern Wisconsin.htm HTML File 5.7 KB Oct 1 2012 3:31 PM
hoax.pdf PDF Document 12.9 MB Oct 1 2012 3:33 PM
hoax.rtf RTF File 16.4 MB Oct 1 2012 3:33 PM
hoax.zip ZIP Archive 2.3 MB Oct 1 2012 3:32 PM
hoax2.pdf PDF Document 1.2 MB Oct 1 2012 3:31 PM
Hockney's Secret Knowledge - Refuted.htm HTML File 2.5 KB Oct 1 2012 3:33 PM
Holger Dansk - Denmark's Mountain King.htm HTML File 19.5 KB Oct 1 2012 3:31 PM
holindustry.pdf PDF Document 554.2 KB Oct 1 2012 3:31 PM
holindustry.rtf RTF File 5.3 MB Oct 1 2012 3:33 PM
HollyhoaxMadeInRussia.pdf PDF Document 17.8 MB Oct 1 2012 3:30 PM
Hollywood Slanders Italian Americans.htm HTML File 4.3 KB Oct 1 2012 3:28 PM
Holo-Jokes.pdf PDF Document 53.9 KB Oct 1 2012 3:33 PM
HolocaustDenial2005.pdf PDF Document 259.4 KB Oct 1 2012 3:32 PM
Holocaust Fraud.htm HTML File 13.2 KB Oct 1 2012 3:31 PM
Holocaust Hoax to be Hammered at Upcoming Conference in Iran.htm HTML File 6.7 KB Oct 1 2012 3:30 PM
Holocaust Lawyer Faces $3.2 Million Malpractice Judgment.htm HTML File 2.6 KB Oct 1 2012 3:33 PM
holocaustorhoax.pdf PDF Document 990.4 KB Oct 1 2012 3:34 PM
holocaustorhoax.rtf RTF File 605.3 KB Oct 1 2012 3:31 PM
HolyBookOfAdolfHitler.pdf PDF Document 141.1 KB Oct 1 2012 3:30 PM
HolyBookOfAdolfHitler.rtf RTF File 186.6 KB Oct 1 2012 3:33 PM
Homeland Security's Casualties.htm HTML File 6.8 KB Oct 1 2012 3:30 PM
Homeland Security Nominee Chertoff Aided 9-11 Terror Suspect.htm HTML File 17.4 KB Oct 1 2012 3:34 PM
Homeless Jack Offers a Primer.htm HTML File 13.3 KB Oct 1 2012 3:28 PM
Homeless Jack on New Orleans.htm HTML File 8.3 KB Oct 1 2012 3:32 PM
Home on the Range.htm HTML File 6.9 KB Oct 1 2012 3:31 PM
Homosexual Groups Trying to Distance Themselves From Foley.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
Honest Money.pdf PDF Document 225 KB Oct 1 2012 3:33 PM
Honoring Robert E. Lee.htm HTML File 10.7 KB Oct 1 2012 3:31 PM
Houston - Turf War Breaks Out between Katrina Refugees, Locals.htm HTML File 3.2 KB Oct 1 2012 3:33 PM
How a Non-White Country Treats Asylum Invaders.htm HTML File 6.1 KB Oct 1 2012 3:30 PM
How Many More Nations Will Israel Attack.htm HTML File 10.3 KB Oct 1 2012 3:34 PM
How Many Tanks Did Israel Lose.htm HTML File 5 KB Oct 1 2012 3:28 PM
How Muslims Deal With Third World Immigrants.htm HTML File 2.9 KB Oct 1 2012 3:27 PM
How New Orleans Was Lost.htm HTML File 3 KB Oct 1 2012 3:33 PM
How Small Genetic Differences Give Racial Divergency.htm HTML File 21.1 KB Oct 1 2012 3:28 PM
How To Burn Bootable Disks & Install OS X from External Volumes.rtf RTF File 13.9 KB Oct 1 2012 3:30 PM
How to Crack CD Protections.pdf PDF Document 30 KB Oct 1 2012 3:31 PM
How to Develop Super Power Memory.pdf PDF Document 2.5 MB Oct 1 2012 3:31 PM
How to rebuild a Li-Ion pack.pdf PDF Document 1.6 MB Oct 1 2012 3:33 PM
How Unskilled Immigrants Hurt Our Economy.htm HTML File 3.7 KB Oct 1 2012 3:33 PM
hsb.pdf PDF Document 442.9 KB Oct 1 2012 3:28 PM
hsb.rtf RTF File 1.2 MB Oct 1 2012 3:29 PM
hsb.zip ZIP Archive 205.4 KB Oct 1 2012 3:30 PM
htpt.pdf PDF Document 864.7 KB Oct 1 2012 3:28 PM
htpt.rtf RTF File 473.6 KB Oct 1 2012 3:34 PM
http__www.hartford-hwp.com_cp-usa.html HTML File 1.9 KB Oct 1 2012 3:31 PM
Hueng Metal Hydrides BCC 033003.pdf PDF Document 898.9 KB Oct 1 2012 3:28 PM
Hugo Chavez - Rise Up Against the Empire.htm HTML File 18.3 KB Oct 1 2012 3:27 PM
human_shields.pdf PDF Document 471.2 KB Oct 1 2012 3:28 PM
humor.html HTML File 21.7 KB Oct 1 2012 3:31 PM
hunter.css Stylesheet 503 Bytes Oct 1 2012 3:28 PM
Hunter.pdf PDF Document 1.1 MB Oct 1 2012 3:33 PM
Hurricane Katrina - Blacks Worsen Disaster.htm HTML File 5.7 KB Oct 1 2012 3:33 PM
Hurricane Katrina and Black Behavior.htm HTML File 4.7 KB Oct 1 2012 3:29 PM
Hurricane Katrina Devastates Duke Headquarters.htm HTML File 6.1 KB Oct 1 2012 3:33 PM
Hurricane Tracking Chart - Atlantic Basin.pdf PDF Document 107.8 KB Oct 1 2012 3:28 PM
Hurricane Tracking Chart - Atlantic Basin West.pdf PDF Document 906.4 KB Oct 1 2012 3:31 PM
Hurricane Tracking Chart - East Pacific.pdf PDF Document 289.3 KB Oct 1 2012 3:33 PM
Hushed-up Israeli Spy Operations against USA and Mexico 2000 - 2003.htm HTML File 34.1 KB Oct 1 2012 3:28 PM
HW1.pdf PDF Document 3.6 MB Oct 1 2012 3:31 PM
hwr60.htm HTML File 35.5 KB Oct 1 2012 3:28 PM
hwr61.htm HTML File 10 KB Oct 1 2012 3:32 PM
HWT-Brizahpage.PDF PDF Document 452.4 KB Oct 1 2012 3:30 PM
HW_Web.pdf PDF Document 3.9 MB Oct 1 2012 3:28 PM
HW_Web_dl.pdf PDF Document 4.6 MB Oct 1 2012 3:27 PM
IfanAgentKnocks.pdf PDF Document 17 KB Oct 1 2012 3:34 PM
If You Tolerate This....htm HTML File 16.8 KB Oct 1 2012 3:28 PM
Igniting the Spark - An Interview With David Duke.htm HTML File 30.5 KB Oct 1 2012 3:29 PM
IHRLeaflets.pdf PDF Document 284.6 KB Oct 1 2012 3:28 PM
IHRupdate_November_2005.pdf PDF Document 1.5 MB Oct 1 2012 3:30 PM
ij01.html HTML File 32.3 KB Oct 1 2012 3:28 PM
ij02.html HTML File 19.7 KB Oct 1 2012 3:28 PM
ij03.html HTML File 20.7 KB Oct 1 2012 3:32 PM
ij04.html HTML File 24.3 KB Oct 1 2012 3:33 PM
ij05.html HTML File 29.5 KB Oct 1 2012 3:27 PM
ij06.html HTML File 15.6 KB Oct 1 2012 3:31 PM
ij07.html HTML File 17.4 KB Oct 1 2012 3:28 PM
ij08.html HTML File 24.9 KB Oct 1 2012 3:28 PM
ij09.html HTML File 26.8 KB Oct 1 2012 3:33 PM
ij10.html HTML File 17.7 KB Oct 1 2012 3:29 PM
ij11.html HTML File 25.1 KB Oct 1 2012 3:33 PM
ij12.html HTML File 26.2 KB Oct 1 2012 3:28 PM
ij13.html HTML File 26.2 KB Oct 1 2012 3:32 PM
ij14.html HTML File 23 KB Oct 1 2012 3:28 PM
ij15.html HTML File 25.6 KB Oct 1 2012 3:32 PM
ij16.html HTML File 26.2 KB Oct 1 2012 3:31 PM
ij17.html HTML File 31 KB Oct 1 2012 3:29 PM
ij18.html HTML File 23.8 KB Oct 1 2012 3:28 PM
ij19.html HTML File 24.3 KB Oct 1 2012 3:29 PM
ij20.html HTML File 24.8 KB Oct 1 2012 3:30 PM
ij21.html HTML File 24.8 KB Oct 1 2012 3:28 PM
ij22.html HTML File 24.1 KB Oct 1 2012 3:33 PM
ij23.html HTML File 25.1 KB Oct 1 2012 3:32 PM
ij24.html HTML File 25.5 KB Oct 1 2012 3:27 PM
ij25.html HTML File 24.1 KB Oct 1 2012 3:28 PM
ij26.html HTML File 21.5 KB Oct 1 2012 3:31 PM
ij27.html HTML File 25.7 KB Oct 1 2012 3:30 PM
ij28.html HTML File 22.7 KB Oct 1 2012 3:31 PM
ij29.html HTML File 16.9 KB Oct 1 2012 3:30 PM
ij30.html HTML File 20.1 KB Oct 1 2012 3:31 PM
ij31.html HTML File 21.3 KB Oct 1 2012 3:28 PM
ij32.html HTML File 22.1 KB Oct 1 2012 3:32 PM
ij33.html HTML File 24.9 KB Oct 1 2012 3:33 PM
ij34.html HTML File 24.2 KB Oct 1 2012 3:29 PM
ij35.html HTML File 28.1 KB Oct 1 2012 3:31 PM
ij36.html HTML File 25.4 KB Oct 1 2012 3:29 PM
ij37.html HTML File 4.5 KB Oct 1 2012 3:31 PM
ij38.html HTML File 15.9 KB Oct 1 2012 3:33 PM
ij39.html HTML File 7.5 KB Oct 1 2012 3:33 PM
ij40.html HTML File 25.9 KB Oct 1 2012 3:30 PM
ij41.html HTML File 26.8 KB Oct 1 2012 3:31 PM
ij42.html HTML File 25.2 KB Oct 1 2012 3:31 PM
ij43.html HTML File 28 KB Oct 1 2012 3:33 PM
ij44.html HTML File 29.7 KB Oct 1 2012 3:30 PM
ij45.html HTML File 29 KB Oct 1 2012 3:31 PM
ij46.html HTML File 26.3 KB Oct 1 2012 3:29 PM
ij47.html HTML File 22.8 KB Oct 1 2012 3:33 PM
ij48.html HTML File 26.6 KB Oct 1 2012 3:33 PM
ij49.html HTML File 26.8 KB Oct 1 2012 3:32 PM
ij50.html HTML File 23.5 KB Oct 1 2012 3:31 PM
ij51.html HTML File 27.9 KB Oct 1 2012 3:30 PM
ij52.html HTML File 25.6 KB Oct 1 2012 3:31 PM
ij53.html HTML File 25.9 KB Oct 1 2012 3:32 PM
ij54.html HTML File 24.7 KB Oct 1 2012 3:31 PM
ij55.html HTML File 24.3 KB Oct 1 2012 3:33 PM
ij56.html HTML File 23.8 KB Oct 1 2012 3:31 PM
ij57.html HTML File 26.3 KB Oct 1 2012 3:27 PM
ij58.html HTML File 25.4 KB Oct 1 2012 3:33 PM
ij59.html HTML File 24.6 KB Oct 1 2012 3:33 PM
ij60.html HTML File 26.1 KB Oct 1 2012 3:28 PM
ij61.html HTML File 27.6 KB Oct 1 2012 3:28 PM
ij62.html HTML File 25.2 KB Oct 1 2012 3:31 PM
ij63.html HTML File 24.6 KB Oct 1 2012 3:31 PM
ij64.html HTML File 20.6 KB Oct 1 2012 3:33 PM
ij65.html HTML File 26.2 KB Oct 1 2012 3:33 PM
ij66.html HTML File 26.5 KB Oct 1 2012 3:28 PM
ij67.html HTML File 27.3 KB Oct 1 2012 3:33 PM
ij68.html HTML File 27.6 KB Oct 1 2012 3:28 PM
ij69.html HTML File 28 KB Oct 1 2012 3:31 PM
ij70.html HTML File 23.6 KB Oct 1 2012 3:33 PM
ij71.html HTML File 23.9 KB Oct 1 2012 3:28 PM
ij72.html HTML File 21.1 KB Oct 1 2012 3:32 PM
ij73.html HTML File 25.3 KB Oct 1 2012 3:30 PM
ij74.html HTML File 22 KB Oct 1 2012 3:30 PM
ij75.html HTML File 25.3 KB Oct 1 2012 3:34 PM
ij76.html HTML File 26 KB Oct 1 2012 3:30 PM
ij77.html HTML File 29.2 KB Oct 1 2012 3:30 PM
ij78.html HTML File 29.2 KB Oct 1 2012 3:31 PM
ij79.html HTML File 23.7 KB Oct 1 2012 3:34 PM
ij80.html HTML File 24.3 KB Oct 1 2012 3:34 PM
Illegal Immigration - War with Mexico Approaches.htm HTML File 3.2 KB Oct 1 2012 3:28 PM
Illegal Immigration and the Racism of 'Antiracism'.htm HTML File 15.8 KB Oct 1 2012 3:31 PM
IllegalImmigrationMyths.pdf PDF Document 75.3 KB Oct 1 2012 3:34 PM
Illegal Immigration Sparks Race War in Cities, Prisions.htm HTML File 7.8 KB Oct 1 2012 3:30 PM
Illegals Demand the 'Right' to Break the Law.htm HTML File 6.7 KB Oct 1 2012 3:33 PM
Illinois Cops - Arabs Beat, Gas Black.htm HTML File 4 KB Oct 1 2012 3:27 PM
immigrationmustcease.pdf PDF Document 109.7 KB Oct 1 2012 3:32 PM
imperium-pdf.zip ZIP Archive 1.3 MB Oct 1 2012 3:28 PM
imperium.css Stylesheet 758 Bytes Oct 1 2012 3:32 PM
imperium.zip ZIP Archive 510.3 KB Oct 1 2012 3:29 PM
Imperium103.pdf PDF Document 1.2 MB Oct 1 2012 3:30 PM
InDefenseOfRacism.pdf PDF Document 288 KB Oct 1 2012 3:32 PM
indexfiles.html HTML File 15 KB Oct 1 2012 3:27 PM
Indian Schools, Genes, Assimilation, and Illegal Aliens.htm HTML File 15.9 KB Oct 1 2012 3:33 PM
Indians Reject Black Claims.htm HTML File 6.3 KB Oct 1 2012 3:31 PM
Indicted - Republican Corporate Whore DeLay Resigns.htm HTML File 4.1 KB Oct 1 2012 3:31 PM
infamy.pdf PDF Document 313.3 KB Oct 1 2012 3:31 PM
Infected Africans Skyrocket AIDS-HIV in Croydon, London.htm HTML File 1.8 KB Oct 1 2012 3:31 PM
In Italy, Al Qaeda Turns to Organized Crime for Protection.htm HTML File 3.7 KB Oct 1 2012 3:31 PM
In Praise of Saudi Arabia.htm HTML File 4.8 KB Oct 1 2012 3:28 PM
Institute for Political & International Studies.htm HTML File 17 KB Oct 1 2012 3:32 PM
InternationalJew.pdf PDF Document 3.1 MB Oct 1 2012 3:29 PM
InternationalJew.rtf RTF File 2.2 MB Oct 1 2012 3:29 PM
Interracial Rape Victim - Called by God to 'Minister Against Racism'.htm HTML File 7.2 KB Oct 1 2012 3:28 PM
Interview with the Grim Reaper - StantonReaper0905.htm HTML File 16.8 KB Oct 1 2012 3:32 PM
intro - National Vanguard.pdf PDF Document 1.4 MB Oct 1 2012 3:32 PM
Intro.htm HTML File 17.1 KB Oct 1 2012 3:28 PM
intro.pdf PDF Document 1.4 MB Oct 1 2012 3:29 PM
Introducing the Global I.D. Card.htm HTML File 2 KB Oct 1 2012 3:31 PM
introduction.html HTML File 9.2 KB Oct 1 2012 3:34 PM
Invasion.pdf PDF Document 27 KB Oct 1 2012 3:33 PM
Iran - The 'Holocaust' Threat to World Peace.htm HTML File 22.3 KB Oct 1 2012 3:34 PM
Iranians Produce Holocaust Cartoons.htm HTML File 5 KB Oct 1 2012 3:32 PM
Iraq - Christians Leery of Islamic 'Tolerance'.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
Iraq at the Gates of Hell.htm HTML File 37.8 KB Oct 1 2012 3:32 PM
IraqGassingLies.pdf PDF Document 81.1 KB Oct 1 2012 3:30 PM
Iraqi Resister - Black Soldiers are Targets.htm HTML File 4.6 KB Oct 1 2012 3:31 PM
irish.pdf PDF Document 1.3 MB Oct 1 2012 3:27 PM
Irish Academics Urge Israel Boycott.htm HTML File 3.5 KB Oct 1 2012 3:31 PM
IronHeel.pdf PDF Document 557.4 KB Oct 1 2012 3:28 PM
Irreconcilable Differences.htm HTML File 152.5 KB Oct 1 2012 3:32 PM
irving.html HTML File 24.9 KB Oct 1 2012 3:34 PM
Is any of this stuff made in Israel.htm HTML File 30.7 KB Oct 1 2012 3:28 PM
Is Europe Unable to Assimilate Its Growing Islamic Minority.htm HTML File 10.8 KB Oct 1 2012 3:30 PM
Islamic Headscarf Ban Debate Hits Australia.htm HTML File 3.3 KB Oct 1 2012 3:31 PM
Islamic Wisdom - 'Rapist' Jailed, 'Victim' Executed.htm HTML File 2.4 KB Oct 1 2012 3:27 PM
Islamists Throng in Europe's Powder Keg.htm HTML File 3.2 KB Oct 1 2012 3:33 PM
Islam versus Christianity – A reply to The Pope!.htm HTML File 58.8 KB Oct 1 2012 3:33 PM
Is Neocon Spokesman Soliciting Murder of David Duke.htm HTML File 6.9 KB Oct 1 2012 3:32 PM
Israel's End Game Gambit Failure_ Hamas Refuses to Allow Israel to Exist.html HTML File 63.2 KB Oct 1 2012 3:32 PM
Israel's Interior Minister - 'Stop Spitting on Christians'.htm HTML File 8 KB Oct 1 2012 3:29 PM
Israel's Secret Weapon.htm HTML File 43 KB Oct 1 2012 3:33 PM
Israel's Sex-Slave Industry Soars.htm HTML File 2.9 KB Oct 1 2012 3:28 PM
Israel - Beyond Good and Evil.htm HTML File 5.7 KB Oct 1 2012 3:27 PM
Israel - New Party Urges Expulsion of Non-Jews.htm HTML File 3.6 KB Oct 1 2012 3:32 PM
Israel - Poll Shows 64 Percent of Israeli Jews Favor Ethnic Cleansing.htm HTML File 3.2 KB Oct 1 2012 3:29 PM
Israel - Was BBC's Peter Hounam Arrested as Punishment.htm HTML File 4.7 KB Oct 1 2012 3:33 PM
israel.pdf PDF Document 531.8 KB Oct 1 2012 3:30 PM
Israel Honors Jewish Terrorists Who Attacked America.htm HTML File 17.3 KB Oct 1 2012 3:31 PM
Israeli-Sponsored Educational Program for NY Schools.htm HTML File 2.5 KB Oct 1 2012 3:31 PM
israeliespionageandillegaltechnologyretransfer.html HTML File 11.1 KB Oct 1 2012 3:27 PM
Israeli Gangster Shot Dead in Russia.htm HTML File 2.5 KB Oct 1 2012 3:28 PM
Israeli Minister Calls for Nasrallah's Death.htm HTML File 2.7 KB Oct 1 2012 3:33 PM
Israel in Hot Water Over New Zealand Spies.htm HTML File 3.9 KB Oct 1 2012 3:28 PM
Israeli Nuclear Whistleblower Vanunu Speaks.htm HTML File 3.7 KB Oct 1 2012 3:29 PM
Israeli PM's party plagiarizes from Texas Democrats.htm HTML File 22.8 KB Oct 1 2012 3:32 PM
IsraeliPrimeMinisterDeclaresJewWarOnIranAndSyria.html HTML File 28.1 KB Oct 1 2012 3:32 PM
Israelis Among the Holocaust Deniers.htm HTML File 2.4 KB Oct 1 2012 3:32 PM
Israeli Sexpionage - The McGreevey, Condit and Clinton Affairs.htm HTML File 12.4 KB Oct 1 2012 3:34 PM
Israelis Launch Voting Guide.htm HTML File 3.5 KB Oct 1 2012 3:31 PM
Israeli Sniper Assassinates Two Children.htm HTML File 3.1 KB Oct 1 2012 3:27 PM
Israeli Spying - The Mother of All Scandals.htm HTML File 2.8 KB Oct 1 2012 3:30 PM
Israelis Win Contract To Secure US Borders.htm HTML File 22.1 KB Oct 1 2012 3:28 PM
Israeli troops seize million dollars in bank raids across West Bank.htm HTML File 2.1 KB Oct 1 2012 3:33 PM
Israeli Website Exposes Jewish Extremism!.htm HTML File 13 KB Oct 1 2012 3:29 PM
Israel Loan Program Limited to Jews.htm HTML File 2.8 KB Oct 1 2012 3:32 PM
IsraelLobbyAndUSForeignPolicy.pdf PDF Document 1.4 MB Oct 1 2012 3:30 PM
Israel Lobby Denial.htm HTML File 14.1 KB Oct 1 2012 3:31 PM
Israel Pushing U.S. to Bomb Iran.htm HTML File 4.3 KB Oct 1 2012 3:32 PM
IsraelSexSlaveTrade.pdf PDF Document 50.9 KB Oct 1 2012 3:28 PM
IsraelSexSlaveTraffic.pdf PDF Document 956 KB Oct 1 2012 3:27 PM
israelsuspectedoftransferringuslaserweapondatatochina.html HTML File 7.9 KB Oct 1 2012 3:33 PM
israelviolatesrulesonmissilesales.html HTML File 5.4 KB Oct 1 2012 3:34 PM
Israel Wants IAEA to Ignore its Nuclear Arsenal, Concentrate on Iran.htm HTML File 3.9 KB Oct 1 2012 3:28 PM
israelweapons.pdf PDF Document 133.8 KB Oct 1 2012 3:30 PM
israelweapons.rtf RTF File 194.5 KB Oct 1 2012 3:31 PM
Israel Will Continue to Hurl Terror Bombs into Gaza Homes, Producing Wounded and Dying Children.html HTML File 44.7 KB Oct 1 2012 3:27 PM
Is There Some Bravery Left in Braveheart.htm HTML File 5.7 KB Oct 1 2012 3:31 PM
It's 1984 in Massachusetts – And Big Brother Is Gay.htm HTML File 15.5 KB Oct 1 2012 3:30 PM
It's Coming to America, Too.htm HTML File 6.2 KB Oct 1 2012 3:33 PM
It's the Genes, Stupid!.htm HTML File 21.8 KB Oct 1 2012 3:31 PM
its_a_deal.pdf PDF Document 1.1 MB Oct 1 2012 3:27 PM
I Was Israel’s Dupe.htm HTML File 5.7 KB Oct 1 2012 3:28 PM
iwc4jan.mp3 MP3 Audio 3.5 MB Oct 1 2012 3:33 PM
I Wonder What The Tiger Thinks.rtf RTF File 3.2 KB Oct 1 2012 3:31 PM
izterrorfile.pdf PDF Document 783 KB Oct 1 2012 3:34 PM
izterrorfile.rtf RTF File 515.3 KB Oct 1 2012 3:33 PM
IzzySecretServicesTruth.rtf RTF File 66.7 KB Oct 1 2012 3:32 PM
IzzySpyRing.pdf PDF Document 2 MB Oct 1 2012 3:30 PM
jackson-report.pdf PDF Document 719 KB Oct 1 2012 3:32 PM
Jagger Rejects Kabbalah after Extortion Attempt.htm HTML File 2.8 KB Oct 1 2012 3:29 PM
James and Cindy; Progress and Hope.htm HTML File 22.6 KB Oct 1 2012 3:31 PM
Jan01.pdf PDF Document 747.2 KB Oct 1 2012 3:28 PM
Jan02.pdf PDF Document 1.2 MB Oct 1 2012 3:28 PM
Jan03.pdf PDF Document 1.6 MB Oct 1 2012 3:32 PM
Jan04.pdf PDF Document 917.6 KB Oct 1 2012 3:27 PM
Janis Ian - 2002-09-16 - THE INTERNET DEBACLE – AN ALTERNATIVE VIEW.htm HTML File 32.8 KB Oct 1 2012 3:32 PM
jaws.pdf PDF Document 320.7 KB Oct 1 2012 3:33 PM
JB Cash - 2006-01-05 - Death of a Hero.htm HTML File 20.5 KB Oct 1 2012 3:29 PM
J Dub Gettin’ Funky in Durham.htm HTML File 3.5 KB Oct 1 2012 3:32 PM
Jeff A. Taylor - 2006-07-24 - Rah-Rah IDF.htm HTML File 3.4 KB Oct 1 2012 3:31 PM
Jerry Falwell Now Supports 'Gay' Rights.htm HTML File 5 KB Oct 1 2012 3:34 PM
jew-archives-previous-latest-additions.htm HTML File 5 KB Oct 1 2012 3:29 PM
jew-atrocities-blackmail_of_nations.html HTML File 2.1 KB Oct 1 2012 3:28 PM
jew-atrocities-egypt1967.html HTML File 25.3 KB Oct 1 2012 3:31 PM
jew-atrocities-folder.html HTML File 4.1 KB Oct 1 2012 3:33 PM
jew-atrocities-hebron.html HTML File 20.4 KB Oct 1 2012 3:29 PM
jew-atrocities-intifada.html HTML File 20.6 KB Oct 1 2012 3:30 PM
jew-atrocities-iraq.html HTML File 15.9 KB Oct 1 2012 3:31 PM
jew-atrocities-israelitorture.htm HTML File 31.8 KB Oct 1 2012 3:34 PM
jew-atrocities-jewsagainstjews.html HTML File 3.5 KB Oct 1 2012 3:31 PM
jew-atrocities-lebanon.html HTML File 76 KB Oct 1 2012 3:31 PM
jew-atrocities-political-correctness-crimes.html HTML File 5.4 KB Oct 1 2012 3:34 PM
jew-atrocities-slaves-jewish-slave-ship-owners.html HTML File 5.8 KB Oct 1 2012 3:28 PM
jew-atrocities-slaves.html HTML File 7.1 KB Oct 1 2012 3:34 PM
jew-communists-HUAC-Lists.htm HTML File 80.4 KB Oct 1 2012 3:27 PM
jew-communists-joe-mccarthy-and-the-jews.html HTML File 42.9 KB Oct 1 2012 3:33 PM
jew-communists-rothschild-banks.html HTML File 53.4 KB Oct 1 2012 3:31 PM
jew-communists.html HTML File 30.4 KB Oct 1 2012 3:31 PM
jew-crime-mob-russia-ussr.html HTML File 101.6 KB Oct 1 2012 3:33 PM
jew-criminalsandspies-bentley.html HTML File 4.1 KB Oct 1 2012 3:31 PM
jew-criminalsandspies-elitcher-max.html HTML File 4.1 KB Oct 1 2012 3:30 PM
jew-criminalsandspies-feklisov.html HTML File 4.9 KB Oct 1 2012 3:31 PM
jew-criminalsandspies-folder.html HTML File 4.4 KB Oct 1 2012 3:30 PM
jew-criminalsandspies-fuchs.html HTML File 6.4 KB Oct 1 2012 3:33 PM
jew-criminalsandspies-gold.html HTML File 4.2 KB Oct 1 2012 3:30 PM
jew-criminalsandspies-greenglass-wife.html HTML File 4 KB Oct 1 2012 3:34 PM
jew-criminalsandspies-greenglass.html HTML File 5.3 KB Oct 1 2012 3:27 PM
jew-criminalsandspies-hall.html HTML File 23.4 KB Oct 1 2012 3:31 PM
jew-criminalsandspies-oppenheimer-robert.html HTML File 10.7 KB Oct 1 2012 3:30 PM
jew-criminalsandspies-perl.html HTML File 5.5 KB Oct 1 2012 3:33 PM
jew-criminalsandspies-pollard.html HTML File 2.9 KB Oct 1 2012 3:30 PM
jew-criminalsandspies-rosenberg.html HTML File 3.8 KB Oct 1 2012 3:32 PM
jew-criminalsandspies-sobell.html HTML File 27.4 KB Oct 1 2012 3:29 PM
jew-criminalsandspies-vanunu.html HTML File 19.1 KB Oct 1 2012 3:28 PM
jew-genocide-black-holocaust-abolition-myth.html HTML File 19.8 KB Oct 1 2012 3:27 PM
jew-genocide-gentilehate.html HTML File 19 KB Oct 1 2012 3:30 PM
jew-genocide-palestinian-qana.htm HTML File 18 KB Oct 1 2012 3:32 PM
jew-genocide-USSRchristians-antisemitismcrime.html HTML File 6 KB Oct 1 2012 3:28 PM
jew-genocide-USSRchristians-JAC.html HTML File 3.9 KB Oct 1 2012 3:30 PM
jew-jewishbankingandfinancialmanipulations-folder.html HTML File 26.4 KB Oct 1 2012 3:33 PM
jew-jewishbankingandfinancialmanipulations-food-companies.html HTML File 9.6 KB Oct 1 2012 3:29 PM
jew-jewishbankingandfinancialmanipulations-islam-off-dow-jones.html HTML File 19.7 KB Oct 1 2012 3:28 PM
jew-jewishbankingandfinancialmanipulations-mcfadden-speech.html HTML File 104.4 KB Oct 1 2012 3:31 PM
jew-jewishbankingandfinancialmanipulations-secretsofthefederalreservebyeustace mullins.html HTML File 602.7 KB Oct 1 2012 3:32 PM
jew-jewishsupremacyassociationsmovements-art-organizations.html HTML File 7.2 KB Oct 1 2012 3:32 PM
jew-jewishsupremacyassociationsmovements-associations.html HTML File 108.2 KB Oct 1 2012 3:28 PM
jew-jewishsupremacyassociationsmovements-cultural-ethnic-associations.html HTML File 14.6 KB Oct 1 2012 3:33 PM
jew-jewishsupremacyassociationsmovements-environment-movements.html HTML File 7 KB Oct 1 2012 3:28 PM
jew-jewishsupremacyassociationsmovements-family-women-sex-gender-issues.html HTML File 13.4 KB Oct 1 2012 3:33 PM
jew-jewishsupremacyassociationsmovements-folder.html HTML File 5.1 KB Oct 1 2012 3:33 PM
jew-jewishsupremacyassociationsmovements-foundations-grants-orgs.html HTML File 7.7 KB Oct 1 2012 3:30 PM
jew-jewishsupremacyassociationsmovements-hate-genocide.html HTML File 7.5 KB Oct 1 2012 3:31 PM
jew-jewishsupremacyassociationsmovements-immigration.html HTML File 6.5 KB Oct 1 2012 3:30 PM
jew-jewishsupremacyassociationsmovements-law-rights.html HTML File 11.8 KB Oct 1 2012 3:31 PM
jew-jewishsupremacyassociationsmovements-mass-media-associations.html HTML File 17.1 KB Oct 1 2012 3:28 PM
jew-jewishsupremacyassociationsmovements-money-business-organizations.html HTML File 15 KB Oct 1 2012 3:27 PM
jew-jewishsupremacyassociationsmovements-politics.html HTML File 22.4 KB Oct 1 2012 3:27 PM
jew-jewishsupremacyassociationsmovements-religious.html HTML File 10.9 KB Oct 1 2012 3:28 PM
jew-jewishsupremacyassociationsmovements-think-tanks-others.html HTML File 12.6 KB Oct 1 2012 3:31 PM
jew-jewishsupremacyassociationsmovements-unions-occupations-others.html HTML File 16.4 KB Oct 1 2012 3:29 PM
jew-jewishsupremacyassociationsmovements-universities.html HTML File 18.4 KB Oct 1 2012 3:31 PM
jew-leaders-attorneys.html HTML File 3 KB Oct 1 2012 3:29 PM
jew-leaders-begin.html HTML File 9 KB Oct 1 2012 3:33 PM
jew-leaders-ben-gurion.html HTML File 87.2 KB Oct 1 2012 3:30 PM
jew-leaders-churchill.html HTML File 6 KB Oct 1 2012 3:33 PM
jew-leaders-dayan.html HTML File 4.6 KB Oct 1 2012 3:27 PM
jew-leaders-eisenhower.html HTML File 7.4 KB Oct 1 2012 3:31 PM
jew-leaders-executives.html HTML File 3.7 KB Oct 1 2012 3:28 PM
jew-leaders-famousjewslist.html HTML File 15.6 KB Oct 1 2012 3:30 PM
jew-leaders-folder.html HTML File 9.3 KB Oct 1 2012 3:34 PM
jew-leaders-frank.html HTML File 2.2 KB Oct 1 2012 3:29 PM
jew-leaders-hertzl.html HTML File 2.7 KB Oct 1 2012 3:28 PM
jew-leaders-kaganovich.html HTML File 45 KB Oct 1 2012 3:31 PM
jew-leaders-kahane.html HTML File 3.4 KB Oct 1 2012 3:34 PM
jew-leaders-luxemberg.html HTML File 24 KB Oct 1 2012 3:27 PM
jew-leaders-mafia.html HTML File 4.5 KB Oct 1 2012 3:30 PM
jew-leaders-netanyahu.html HTML File 3.1 KB Oct 1 2012 3:34 PM
jew-leaders-rabin.html HTML File 1.9 KB Oct 1 2012 3:31 PM
jew-leaders-roosevelt.html HTML File 5.7 KB Oct 1 2012 3:31 PM
jew-leaders-rothschild.html HTML File 5.1 KB Oct 1 2012 3:31 PM
jew-leaders-stalin.html HTML File 7.3 KB Oct 1 2012 3:32 PM
jew-leaders-trotsky.htm HTML File 6.5 KB Oct 1 2012 3:30 PM
jew-leaders-ussr-pm-yevgeny-primakov.html HTML File 3.6 KB Oct 1 2012 3:31 PM
jew-leaders-yagoda.html HTML File 5 KB Oct 1 2012 3:32 PM
jew-mafia.htm HTML File 26 KB Oct 1 2012 3:33 PM
jew-mindcontrol-anarchism.html HTML File 12.1 KB Oct 1 2012 3:29 PM
jew-mindcontrol-atheism.html HTML File 87.9 KB Oct 1 2012 3:30 PM
jew-mindcontrol-civil-rights.html HTML File 9.4 KB Oct 1 2012 3:30 PM
jew-mindcontrol-communism.html HTML File 8.3 KB Oct 1 2012 3:27 PM
jew-mindcontrol-feminism.html HTML File 25.4 KB Oct 1 2012 3:30 PM
jew-mindcontrol-folder.html HTML File 3.8 KB Oct 1 2012 3:29 PM
jew-mindcontrol-freudianism.html HTML File 59.7 KB Oct 1 2012 3:33 PM
jew-mindcontrol-homosexuality.html HTML File 13.5 KB Oct 1 2012 3:28 PM
jew-mindcontrol-immigration.html HTML File 3.8 KB Oct 1 2012 3:33 PM
jew-mindcontrol-liberalism.html HTML File 5 KB Oct 1 2012 3:34 PM
jew-mindcontrol-new-left.html HTML File 319.3 KB Oct 1 2012 3:28 PM
jew-occupiedgovernments-australia.html HTML File 2.1 KB Oct 1 2012 3:29 PM
jew-occupiedgovernments-austria.html HTML File 3.7 KB Oct 1 2012 3:30 PM
jew-occupiedgovernments-CIS.html HTML File 2.5 KB Oct 1 2012 3:30 PM
jew-occupiedgovernments-folder.html HTML File 2.4 KB Oct 1 2012 3:32 PM
jew-occupiedgovernments-france.html HTML File 5.5 KB Oct 1 2012 3:31 PM
jew-occupiedgovernments-germany-hitlers-jew-support.html HTML File 13.2 KB Oct 1 2012 3:33 PM
jew-occupiedgovernments-germany.html HTML File 27.6 KB Oct 1 2012 3:32 PM
jew-occupiedgovernments-israel-iq.html HTML File 148.9 KB Oct 1 2012 3:33 PM
jew-occupiedgovernments-israel.html HTML File 46.7 KB Oct 1 2012 3:27 PM
jew-occupiedgovernments-poland.html HTML File 7.1 KB Oct 1 2012 3:28 PM
jew-occupiedgovernments-uk.html HTML File 11.7 KB Oct 1 2012 3:34 PM
jew-occupiedgovernments-usa-sds.html HTML File 17.1 KB Oct 1 2012 3:31 PM
jew-occupiedgovernments-usa.html HTML File 44.6 KB Oct 1 2012 3:30 PM
jew-occupiedgovernments-USSR-historians.html HTML File 19.6 KB Oct 1 2012 3:32 PM
jew-occupiedgovernments-USSR-jewish-bolsheviks-answer.com.html HTML File 34 KB Oct 1 2012 3:33 PM
jew-occupiedgovernments-USSR-Jewish-Bolshevism-Bolsheviks.html HTML File 58.4 KB Oct 1 2012 3:29 PM
jew-occupiedgovernments-USSR-moreevidence - Historical Sources.htm HTML File 36.4 KB Oct 1 2012 3:31 PM
jew-occupiedgovernments-USSR-moreevidence.html HTML File 35.7 KB Oct 1 2012 3:33 PM
jew-occupiedgovernments-USSR-revolution.html HTML File 8.9 KB Oct 1 2012 3:28 PM
jew-occupiedgovernments-USSR-victim-email.html HTML File 5.4 KB Oct 1 2012 3:33 PM
jew-occupiedgovernments-USSR.html HTML File 122.5 KB Oct 1 2012 3:34 PM
jew-occupiedgovernments-vatican.html HTML File 25.7 KB Oct 1 2012 3:32 PM
jew-organizations-ACLU.html HTML File 2.9 KB Oct 1 2012 3:32 PM
jew-organizations-ADL.html HTML File 190.4 KB Oct 1 2012 3:33 PM
jew-organizations-AIPAC.html HTML File 8.1 KB Oct 1 2012 3:33 PM
jew-organizations-bnaibrith.html HTML File 30 KB Oct 1 2012 3:28 PM
jew-organizations-folder.html HTML File 3.8 KB Oct 1 2012 3:28 PM
jew-organizations-JDL-Zionist-Terror-Network-IHR.htm HTML File 107.4 KB Oct 1 2012 3:27 PM
jew-organizations-JDL.html HTML File 3.1 KB Oct 1 2012 3:28 PM
jew-organizations-jewishbund.html HTML File 4.3 KB Oct 1 2012 3:29 PM
jew-organizations-NAACP.html HTML File 5.2 KB Oct 1 2012 3:29 PM
jew-organizations-NOW.html HTML File 3.8 KB Oct 1 2012 3:32 PM
jew-organizations-penetration-white-european-orgs.html HTML File 14.3 KB Oct 1 2012 3:28 PM
jew-organizations-splc.html HTML File 12.7 KB Oct 1 2012 3:27 PM
jew-organizations-wiesenthal.html HTML File 147 KB Oct 1 2012 3:31 PM
jew-organizations-WZO.html HTML File 10.4 KB Oct 1 2012 3:31 PM
jew-radio-folder.html HTML File 11.7 KB Oct 1 2012 3:32 PM
jew-references-blogs.html HTML File 13.8 KB Oct 1 2012 3:34 PM
jew-references-daskapital.html HTML File 3.7 KB Oct 1 2012 3:31 PM
jew-references-gentile-whatotherssay - What world famous men said about the Jews.htm HTML File 86.4 KB Oct 1 2012 3:33 PM
jew-religions-judaism.html HTML File 2.9 KB Oct 1 2012 3:31 PM
jew-religions-millenium.html HTML File 6.3 KB Oct 1 2012 3:33 PM
jew-terrorists-aipac-pentagon.html HTML File 3.5 KB Oct 1 2012 3:27 PM
jew-terrorists-folder.html HTML File 5.1 KB Oct 1 2012 3:31 PM
jew-terrorists-jewish-zionist-terrorists.html HTML File 14.8 KB Oct 1 2012 3:32 PM
jew-terrorists-mossad.html HTML File 80.4 KB Oct 1 2012 3:30 PM
jew-terrorists-shin_bet.html HTML File 14.6 KB Oct 1 2012 3:31 PM
jew-usenet.html HTML File 2.1 KB Oct 1 2012 3:28 PM
jew1.jpg JPEG Image 46.2 KB Oct 1 2012 3:33 PM
jew2.jpg JPEG Image 52.8 KB Oct 1 2012 3:34 PM
jewbrain.jpg JPEG Image 33.1 KB Oct 1 2012 3:29 PM
JewDefectorWarnAmerica.pdf PDF Document 31.8 KB Oct 1 2012 3:32 PM
JewExpulsions.pdf PDF Document 16.9 KB Oct 1 2012 3:28 PM
jewface.exe DOS/WIN Executable 10.5 MB Oct 1 2012 3:27 PM
JewImmigrationPolicy.pdf PDF Document 163.5 KB Oct 1 2012 3:34 PM
Jewish 'Muslim' Threatens West with Genocide.htm HTML File 4.1 KB Oct 1 2012 3:27 PM
Jewish Academic Blasts Middle-class Whites for Not 'Integrating' Kids.htm HTML File 5.1 KB Oct 1 2012 3:31 PM
Jewish Anti-Gentile Hatred in Porn Industry.htm HTML File 4.6 KB Oct 1 2012 3:29 PM
Jewish Censors Seek to Ban Dissident White Historian.htm HTML File 2.4 KB Oct 1 2012 3:33 PM
JEWISH CRIME.htm HTML File 125.8 KB Oct 1 2012 3:27 PM
Jewish Genetic Diseases.htm HTML File 39.5 KB Oct 1 2012 3:32 PM
Jewish Genetic Diseases 2.htm HTML File 25.8 KB Oct 1 2012 3:31 PM
Jewish Hate, the Media, and the ADL.htm HTML File 23.1 KB Oct 1 2012 3:31 PM
JewishHistoryJewishReligion.pdf PDF Document 420.7 KB Oct 1 2012 3:28 PM
jewish involvement in immigration.pdf PDF Document 191.7 KB Oct 1 2012 3:31 PM
Jewish Lawyer Edward Fagan to Sue African Marxists.htm HTML File 4.3 KB Oct 1 2012 3:29 PM
Jewish Leader Calls On Zionists To Kill All Palestinian Males.htm HTML File 25.4 KB Oct 1 2012 3:31 PM
Jewish Mafia Expands White Slave Trade to London.htm HTML File 2.4 KB Oct 1 2012 3:30 PM
Jewish Porn King May Have Skipped to Israel.htm HTML File 3.4 KB Oct 1 2012 3:31 PM
Jewish rabbi calls for extermination of all Palestinian males.htm HTML File 7.2 KB Oct 1 2012 3:33 PM
JewishRitualMurder.pdf PDF Document 301.7 KB Oct 1 2012 3:31 PM
jewish stake in immigration.pdf PDF Document 93.5 KB Oct 1 2012 3:30 PM
Jewish Support for Open Borders - Is it Biological.htm HTML File 8.8 KB Oct 1 2012 3:27 PM
jewishsupremacism.pdf PDF Document 3.3 MB Oct 1 2012 3:31 PM
jewish supremacism preface.pdf PDF Document 85 KB Oct 1 2012 3:33 PM
Jewish Supremacist Michael Chertoff Named Head of Homeland Security.htm HTML File 10.4 KB Oct 1 2012 3:31 PM
Jewish Supremacists Shaping Election of UN Secretary General.htm HTML File 9 KB Oct 1 2012 3:32 PM
JewishTalmudOrg.PDF PDF Document 1.1 MB Oct 1 2012 3:33 PM
Jewish Terrorist Gets Prison.htm HTML File 3.3 KB Oct 1 2012 3:30 PM
Jewish Usury and Finance Capital.htm HTML File 39.8 KB Oct 1 2012 3:27 PM
Jewish Voters Object to New Polling Place.htm HTML File 2.8 KB Oct 1 2012 3:33 PM
Jewish Voters Object to New Polling Place2.htm HTML File 7.3 KB Oct 1 2012 3:33 PM
JewishWarOfSurvival.pdf PDF Document 182.4 KB Oct 1 2012 3:31 PM
Jewish WMD Whistleblower Vanunu Released But Not Free.htm HTML File 10.2 KB Oct 1 2012 3:31 PM
JewishWorldConquest.rtf RTF File 125.9 KB Oct 1 2012 3:28 PM
jewish_media_control.pdf PDF Document 627.4 KB Oct 1 2012 3:33 PM
jewish_supremacism.pdf PDF Document 3.3 MB Oct 1 2012 3:32 PM
jewquestion.pdf PDF Document 706.1 KB Oct 1 2012 3:34 PM
jewquestion.rtf RTF File 381.2 KB Oct 1 2012 3:33 PM
JewReligionInfluenceToday.pdf PDF Document 1.5 MB Oct 1 2012 3:33 PM
JewRoleInBolshevikRevolution.pdf PDF Document 119.3 KB Oct 1 2012 3:32 PM
Jews - A Religious Community, a People, or a Race.htm HTML File 5.9 KB Oct 1 2012 3:33 PM
jews.html HTML File 40 KB Oct 1 2012 3:32 PM
jews.jpg JPEG Image 21.5 KB Oct 1 2012 3:27 PM
Jews Admit - Iran Is Israel’s “Greatest Threat”.htm HTML File 4.1 KB Oct 1 2012 3:31 PM
JewsAndTheirLies.pdf PDF Document 265.4 KB Oct 1 2012 3:31 PM
Jews And Their Zionist Views.htm HTML File 13.6 KB Oct 1 2012 3:30 PM
JewsAtSteeringWheel.pdf PDF Document 108.8 KB Oct 1 2012 3:28 PM
jews beat Santa Clause.htm HTML File 30.2 KB Oct 1 2012 3:33 PM
jewsgermany.jpg JPEG Image 261.5 KB Oct 1 2012 3:34 PM
JewsIQ.pdf PDF Document 1.7 MB Oct 1 2012 3:31 PM
Jews Push Homosexual 'Reality' TV Shows.htm HTML File 3.6 KB Oct 1 2012 3:30 PM
Jews Relentless In Pursuit of Internet Censorship.htm HTML File 13.2 KB Oct 1 2012 3:34 PM
Jew Threatens LA With New 9-11.htm HTML File 7 KB Oct 1 2012 3:32 PM
Jingle Jam Chaos Closes Minnesota Mall.htm HTML File 3.6 KB Oct 1 2012 3:28 PM
John Barleycorn.htm HTML File 3.8 KB Oct 1 2012 3:30 PM
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency.htm HTML File 26.1 KB Oct 1 2012 3:33 PM
John Bean - 2005-11-02 - How Small Genetic Differences Give Racial Divergency.txt Text File 18 KB Oct 1 2012 3:28 PM
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution, continued.htm HTML File 60.6 KB Oct 1 2012 3:27 PM
John H. Campbell - 2006-04-21 - The Moral Imperative of Our Future Evolution.htm HTML File 75.2 KB Oct 1 2012 3:33 PM
John H. Campbell - The Moral Imperative of Our Future Evolution.htm HTML File 108.1 KB Oct 1 2012 3:31 PM
JohnJayJewel.pdf PDF Document 102 KB Oct 1 2012 3:32 PM
John Moffat - 2005-08-15 - How Whites Won and Lost a Continent.txt Text File 14.9 KB Oct 1 2012 3:30 PM
John Tyndall - An Anagogical View of Empire.htm HTML File 8.5 KB Oct 1 2012 3:28 PM
Journalist Held In Dungeon Of Filth.htm HTML File 1.9 KB Oct 1 2012 3:28 PM
joys.pdf PDF Document 287.1 KB Oct 1 2012 3:32 PM
JudaismInMusic.pdf PDF Document 72.5 KB Oct 1 2012 3:31 PM
judeadeclareswar.pdf PDF Document 84.4 KB Oct 1 2012 3:31 PM
Judea declares war on Germany.htm HTML File 28.6 KB Oct 1 2012 3:31 PM
Judeo-Fascism.htm HTML File 3.7 KB Oct 1 2012 3:27 PM
Jul02.pdf PDF Document 1.7 MB Oct 1 2012 3:34 PM
Jul03.pdf PDF Document 779.3 KB Oct 1 2012 3:34 PM
Jul04.pdf PDF Document 749.2 KB Oct 1 2012 3:33 PM
July01.pdf PDF Document 773.2 KB Oct 1 2012 3:28 PM
Jun01.pdf PDF Document 1.2 MB Oct 1 2012 3:33 PM
Jun02.pdf PDF Document 1.4 MB Oct 1 2012 3:29 PM
Jun03.pdf PDF Document 684.4 KB Oct 1 2012 3:31 PM
Jun04.pdf PDF Document 1 MB Oct 1 2012 3:31 PM
Jury Selection to Be Moved in Bloodbath Trial.htm HTML File 2.7 KB Oct 1 2012 3:33 PM
JustificationOfTerror.pdf PDF Document 13.1 KB Oct 1 2012 3:34 PM
just_say_yes.pdf PDF Document 753.4 KB Oct 1 2012 3:32 PM
Kaballah Crazy!.htm HTML File 3.6 KB Oct 1 2012 3:30 PM
Kabbalah Red String Market Threatened.htm HTML File 3.4 KB Oct 1 2012 3:31 PM
Kalevala.pdf PDF Document 1 MB Oct 1 2012 3:31 PM
Kathleen Christiso - 2006-09-12 - The Coming Collapse of Zionism.htm HTML File 33 KB Oct 1 2012 3:30 PM
Katrina, Iraq, and the Know-It-All Syndrome.htm HTML File 3.7 KB Oct 1 2012 3:34 PM
Katrina - Neo-con Pals Rake in the Dough.htm HTML File 3.5 KB Oct 1 2012 3:32 PM
Katrina and the Black Tsunami.htm HTML File 29.1 KB Oct 1 2012 3:30 PM
Katrina Black Tells Fox You Owe Him.htm HTML File 5.2 KB Oct 1 2012 3:28 PM
Katrina Evacuee Charged with Child Murder.htm HTML File 3.5 KB Oct 1 2012 3:31 PM
Katrina Evacuees Binge on Cape Cod.htm HTML File 4.1 KB Oct 1 2012 3:28 PM
Katrina Students Spark Constitutional Debate.htm HTML File 3.4 KB Oct 1 2012 3:29 PM
Katrina Tensions - School Official Resigns over Remarks.htm HTML File 3.4 KB Oct 1 2012 3:27 PM
Katrina Threatens Croatian-American Tradition.htm HTML File 4.4 KB Oct 1 2012 3:31 PM
Katrina Threatens to Swamp Utah.htm HTML File 5.6 KB Oct 1 2012 3:28 PM
Katrina Unleashes HIV+ Horde.htm HTML File 3.7 KB Oct 1 2012 3:27 PM
Katrina Victims Unwelcome in Some Towns.htm HTML File 3.8 KB Oct 1 2012 3:33 PM
kdrebel.pdf PDF Document 424.8 KB Oct 1 2012 3:31 PM
kdrebel.rtf RTF File 317.7 KB Oct 1 2012 3:28 PM
Keitel.pdf PDF Document 1.2 MB Oct 1 2012 3:32 PM
Kenya - Black Priest Kills White Roman Catholic Bishop.htm HTML File 2.9 KB Oct 1 2012 3:31 PM
Kill a Cracker Day.htm HTML File 2.2 KB Oct 1 2012 3:30 PM
Kill Arabs, Cry Anti-Semitism.htm HTML File 4.5 KB Oct 1 2012 3:34 PM
Killer Plays Race Card.htm HTML File 6.9 KB Oct 1 2012 3:27 PM
Kill the Christians.htm HTML File 3.3 KB Oct 1 2012 3:28 PM
Kirkby TV Covers Reconquista.htm HTML File 3.3 KB Oct 1 2012 3:33 PM
KKKChristmasCardDOUBLEfold.pdf PDF Document 292.3 KB Oct 1 2012 3:31 PM
KKKChristmasCardSINGLEfold.pdf PDF Document 315.9 KB Oct 1 2012 3:34 PM
Klassen.pdf PDF Document 390.5 KB Oct 1 2012 3:30 PM
KlassenCD-Insert.pdf PDF Document 86.5 KB Oct 1 2012 3:33 PM
KlassenCD-ReOrderForm.pdf PDF Document 69.4 KB Oct 1 2012 3:30 PM
KlassenCD-TrayLiner.pdf PDF Document 578.4 KB Oct 1 2012 3:30 PM
know_your_rights.pdf PDF Document 7.6 KB Oct 1 2012 3:28 PM
Kook Conspiracy Theories - Reject Them.htm HTML File 11.4 KB Oct 1 2012 3:33 PM
KosherFoodTax.pdf PDF Document 3.5 MB Oct 1 2012 3:28 PM
Kosovo - A Dangerous Cosmetic Salon.htm HTML File 2.4 KB Oct 1 2012 3:29 PM
kp-3.pdf PDF Document 2.2 MB Oct 1 2012 3:33 PM
KULA.pdf PDF Document 5.8 MB Oct 1 2012 3:27 PM
Kurdish soldiers trained by Israelis.htm HTML File 4.5 KB Oct 1 2012 3:28 PM
Lamb Gaede - 11-year-old White Girl Stands for Truth in California.htm HTML File 5.8 KB Oct 1 2012 3:31 PM
Lambing Flat.htm HTML File 8.9 KB Oct 1 2012 3:33 PM
Land Of Dope And Jewry.htm HTML File 22.5 KB Oct 1 2012 3:33 PM
La Pauvre Petite - Schoolgirl abduction-murder rivets France.htm HTML File 4.8 KB Oct 1 2012 3:31 PM
Lapdance King, Lawyer Indicted in 'Mafia' Probe.htm HTML File 5.1 KB Oct 1 2012 3:34 PM
La Raza List of Corporate Traitors.htm HTML File 9.1 KB Oct 1 2012 3:28 PM
LatviaYearOfHorror.pdf PDF Document 6.6 MB Oct 1 2012 3:31 PM
Law Enforcement Embattled in New Orleans.htm HTML File 2.9 KB Oct 1 2012 3:31 PM
leaderlessresistance.htm HTML File 22.1 KB Oct 1 2012 3:28 PM
LeaderlessResistance.pdf PDF Document 53.4 KB Oct 1 2012 3:31 PM
LearningAboutHomos.pdf PDF Document 1.2 MB Oct 1 2012 3:31 PM
Leftist Violence Flares at Norwegian Election Event.htm HTML File 2.6 KB Oct 1 2012 3:33 PM
leif_eriksson.pdf PDF Document 395.2 KB Oct 1 2012 3:32 PM
lemmingsrefusetoacceptfactsofracialdifferencesinintelligence.html HTML File 4.3 KB Oct 1 2012 3:31 PM
Letter - A Father Pleads for His Son's Future.htm HTML File 4.6 KB Oct 1 2012 3:34 PM
Letter from Atlanta - The Seamy Gold Club Trial.htm HTML File 20.4 KB Oct 1 2012 3:29 PM
LeuchterReport.pdf PDF Document 2.2 MB Oct 1 2012 3:30 PM
Levithian.pdf PDF Document 1 MB Oct 1 2012 3:29 PM
LFS-BOOK-6.2.pdf PDF Document 797.5 KB Oct 1 2012 3:31 PM
LFS - essential_prereading Unknown 12.7 KB Oct 1 2012 3:30 PM
LiarWeasel.pdf PDF Document 62.8 KB Oct 1 2012 3:33 PM
Libby - press_advisory_1028.pdf PDF Document 34.3 KB Oct 1 2012 3:28 PM
libby_indictment_28102005.pdf PDF Document 152.6 KB Oct 1 2012 3:33 PM
Liberating America From Israel.htm HTML File 9.6 KB Oct 1 2012 3:33 PM
LifeIn3rdReich.pdf PDF Document 55.6 KB Oct 1 2012 3:28 PM
LifeInHitlersGermany.pdf PDF Document 446 KB Oct 1 2012 3:28 PM
Light for Nations - A Short History of the Jews in the Modern World.txt Text File 60 KB Oct 1 2012 3:32 PM
lightningsun.pdf PDF Document 1.4 MB Oct 1 2012 3:33 PM
lightningsun.rtf RTF File 5.3 MB Oct 1 2012 3:28 PM
links.html HTML File 34.6 KB Oct 1 2012 3:28 PM
Links Of White Interest.txt Text File 4.9 KB Oct 1 2012 3:31 PM
Linux+IPv6-HOWTO.pdf PDF Document 769.1 KB Oct 1 2012 3:30 PM
lipshit.pdf PDF Document 1.5 MB Oct 1 2012 3:30 PM
Lisa Rad - 2006-02-15 - Fall of the Fourth Reich.htm HTML File 50.7 KB Oct 1 2012 3:31 PM
list-of-jews.htm HTML File 464.7 KB Oct 1 2012 3:30 PM
littlemary-mp3.ram RAM File 67 Bytes Oct 1 2012 3:32 PM
littlemary.mp3 MP3 Audio 3.3 MB Oct 1 2012 3:32 PM
London - Jewish Mafia Loses Three Soldiers.htm HTML File 6.5 KB Oct 1 2012 3:27 PM
London Mayor Challenges Suspension.htm HTML File 2.7 KB Oct 1 2012 3:28 PM
Looking to Belong.htm HTML File 6.5 KB Oct 1 2012 3:30 PM
LordOfTheRings.pdf PDF Document 13 MB Oct 1 2012 3:30 PM
lost_boy.pdf PDF Document 291 KB Oct 1 2012 3:33 PM
lost_boy_2.pdf PDF Document 328.3 KB Oct 1 2012 3:30 PM
lotrlit.zip ZIP Archive 1.5 MB Oct 1 2012 3:31 PM
Louis Beam - Leaderless Resistance - 1983.pdf PDF Document 53.4 KB Oct 1 2012 3:31 PM
Louisiana - Town's First Black Police Chief Charged in Crack Probe.htm HTML File 4.5 KB Oct 1 2012 3:34 PM
Louisiana National Guard Troops Watch Katrina from Iraq.htm HTML File 3.1 KB Oct 1 2012 3:33 PM
Louisiana Senator Threatens To Assault Bush.htm HTML File 4.4 KB Oct 1 2012 3:30 PM
love-your-race.pdf PDF Document 281 KB Oct 1 2012 3:29 PM
Low-paid illegal work force has little impact on prices - 2.htm HTML File 33.1 KB Oct 1 2012 3:33 PM
Low-paid illegal work force has little impact on prices.htm HTML File 12.3 KB Oct 1 2012 3:31 PM
lwb.pdf PDF Document 205.2 KB Oct 1 2012 3:27 PM
M. P. Shiel - 2006-03-07 - Equality, Democracy, and their Killing Fields.htm HTML File 17.2 KB Oct 1 2012 3:31 PM
MacQueen.pdf PDF Document 692.4 KB Oct 1 2012 3:31 PM
MacWorld US - 2007 04.pdf PDF Document 23.5 MB Oct 1 2012 3:33 PM
Madame_Guillotine.pdf PDF Document 114.8 KB Oct 1 2012 3:31 PM
Madonna Listed Among America's 'Most Powerful Jews'.htm HTML File 4.9 KB Oct 1 2012 3:30 PM
MagnaCarta.pdf PDF Document 29.8 KB Oct 1 2012 3:27 PM
main.css Stylesheet 1022 Bytes Oct 1 2012 3:32 PM
maine.pdf PDF Document 571.1 KB Oct 1 2012 3:27 PM
maine_rape.pdf PDF Document 718.9 KB Oct 1 2012 3:32 PM
Make Your Cheque out to God-Cash.htm HTML File 3.4 KB Oct 1 2012 3:29 PM
Mali - Africans Still Practice Human Sacrifice.htm HTML File 8.3 KB Oct 1 2012 3:34 PM
MalleusAcrobat.pdf PDF Document 2.4 MB Oct 1 2012 3:31 PM
malleus_maleficarum.zip ZIP Archive 795.3 KB Oct 1 2012 3:28 PM
ManagementSummary-V2.2.pdf PDF Document 1.1 MB Oct 1 2012 3:33 PM
manifeste.pdf PDF Document 567.8 KB Oct 1 2012 3:30 PM
Mar01.pdf PDF Document 895.5 KB Oct 1 2012 3:31 PM
Mar02.pdf PDF Document 1.4 MB Oct 1 2012 3:31 PM
Mar03.pdf PDF Document 1 MB Oct 1 2012 3:31 PM
Mar04.pdf PDF Document 1.2 MB Oct 1 2012 3:31 PM
Mar06.pdf PDF Document 807 KB Oct 1 2012 3:32 PM
marchupcountry.pdf PDF Document 891.6 KB Oct 1 2012 3:31 PM
marchupcountry.rtf RTF File 2.3 MB Oct 1 2012 3:29 PM
Marcus Epstein and Michelle Malkin.htm HTML File 24.7 KB Oct 1 2012 3:33 PM
MaresNest.pdf PDF Document 1.1 MB Oct 1 2012 3:32 PM
Marian Evans -- Catastrophe in Kansas City.htm HTML File 81.4 KB Oct 1 2012 3:31 PM
Mariel Deja Vu.htm HTML File 4.1 KB Oct 1 2012 3:33 PM
Mark Weber - 2004-07-09 - ADL Strongman Panics at Break in 'Holocaust' Party Line.txt Text File 18.8 KB Oct 1 2012 3:28 PM
Mark Weber - 2006-02-10 - Holocaust Survivor Memoir Exposed as Fraud.htm HTML File 7.6 KB Oct 1 2012 3:32 PM
Mark Weber - 2006-03-16 - The Jewish Role in the Bolshevik Revolution and Russia's Early Soviet Regime.htm HTML File 18.3 KB Oct 1 2012 3:32 PM
Marshall - The Last Circle (unpublished manuscript on the Octopus mafia organization) (1994).pdf PDF Document 471.7 KB Oct 1 2012 3:32 PM
Marshals - Innocent People Placed On 'Watch List' To Meet Quota.htm HTML File 3.5 KB Oct 1 2012 3:33 PM
Marxists Gamble on Geeks.htm HTML File 11.6 KB Oct 1 2012 3:28 PM
MaryPhaghanSong.htm HTML File 9.5 KB Oct 1 2012 3:33 PM
Mass Grave Containing Kosovo Serbs Found.htm HTML File 2.9 KB Oct 1 2012 3:28 PM
Mass Grave of Massacred Poles Found in Ukraine.htm HTML File 25.9 KB Oct 1 2012 3:29 PM
Massive Debt Could Trigger Great Depression.htm HTML File 4.5 KB Oct 1 2012 3:32 PM
Matthew Downing - 2006-03-24 - Massachusetts - Pro-White Outreach Frustrates Local Media, ADL.htm HTML File 15.7 KB Oct 1 2012 3:33 PM
Matthew Hale - Justice Denied.htm HTML File 12.6 KB Oct 1 2012 3:31 PM
May01.pdf PDF Document 791.5 KB Oct 1 2012 3:30 PM
May02.pdf PDF Document 1.5 MB Oct 1 2012 3:27 PM
May03.pdf PDF Document 1 MB Oct 1 2012 3:29 PM
May04.pdf PDF Document 1.2 MB Oct 1 2012 3:33 PM
MBOE.pdf PDF Document 5.7 MB Oct 1 2012 3:30 PM
mcveigh.htm HTML File 24 KB Oct 1 2012 3:30 PM
mcveigh.pdf PDF Document 136.3 KB Oct 1 2012 3:33 PM
mediabypass.pdf PDF Document 745.4 KB Oct 1 2012 3:29 PM
Media Note - 'Michael Savage' Lashes Out Against Nick Berg and His Family.htm HTML File 2.5 KB Oct 1 2012 3:31 PM
Medicating heretics.htm HTML File 9.1 KB Oct 1 2012 3:33 PM
meet_your_neighbors.pdf PDF Document 1.6 MB Oct 1 2012 3:32 PM
MeinKampf.pdf PDF Document 1.2 MB Oct 1 2012 3:33 PM
meinkampf.rtf RTF File 3.5 MB Oct 1 2012 3:31 PM
meinkampf.zip ZIP Archive 702.5 KB Oct 1 2012 3:31 PM
Melchizedek_Drunvalo_#BF2F1.pdf PDF Document 3.9 MB Oct 1 2012 3:28 PM
Mel Gibson's Anti-Zionist Priest Dies.htm HTML File 8 KB Oct 1 2012 3:31 PM
Mel Gibson Denounces Jews' War.htm HTML File 24 KB Oct 1 2012 3:33 PM
memberapp.html HTML File 2.8 KB Oct 1 2012 3:28 PM
Memo Proves Brown Paid for Chertoff's Incompetence.htm HTML File 3.6 KB Oct 1 2012 3:33 PM
memories%20of%20freedom.pdf PDF Document 4.5 MB Oct 1 2012 3:30 PM
menu.htm HTML File 18 KB Oct 1 2012 3:30 PM
Merry Christmas -- and on to Victory!.htm HTML File 10.7 KB Oct 1 2012 3:29 PM
Merry Orthodox Christmas.htm HTML File 2.5 KB Oct 1 2012 3:28 PM
Mestizo Gangs Control the Suburbs.htm HTML File 2.6 KB Oct 1 2012 3:30 PM
Mestizos too violent for open debate, crowd control impossible.htm HTML File 2.7 KB Oct 1 2012 3:28 PM
Mexico Conquers Texas.htm HTML File 2.4 KB Oct 1 2012 3:33 PM
Mexico Ups the Ante in Conflict with American Blacks.htm HTML File 2.3 KB Oct 1 2012 3:33 PM
Michael Chertoff - 'Trust Us'.htm HTML File 5.8 KB Oct 1 2012 3:31 PM
Michael O'Meara - 2005-11-05 - Katrina's Intimation of the End - Afterthoughts on the Impending Catastrophe.txt Text File 15.7 KB Oct 1 2012 3:32 PM
Middle Class Families in Worse Shape Than Ever, Study Finds.htm HTML File 2.7 KB Oct 1 2012 3:31 PM
Milch.pdf PDF Document 2.3 MB Oct 1 2012 3:31 PM
MillerPuckette Book 06-2007.pdf PDF Document 1.9 MB Oct 1 2012 3:28 PM
minimanual.htm HTML File 28.5 KB Oct 1 2012 3:27 PM
Minnesotans Love Non-Whites.htm HTML File 2.2 KB Oct 1 2012 3:27 PM
Minnesota Shocker - Black Muslim Wins Primary.htm HTML File 3.6 KB Oct 1 2012 3:29 PM
minoritieslagdespitefcatgains.html HTML File 5.8 KB Oct 1 2012 3:33 PM
minoritytestscoregap.html HTML File 6.6 KB Oct 1 2012 3:34 PM
misc.html HTML File 31.5 KB Oct 1 2012 3:33 PM
Miscegenator Murders White 'Girlfriend' and Unborn Child.htm HTML File 3.3 KB Oct 1 2012 3:29 PM
missing.pdf PDF Document 1 MB Oct 1 2012 3:32 PM
Mission Fights Eastern European Sex Slave Traffic.htm HTML File 3.8 KB Oct 1 2012 3:33 PM
Mistrial for Accused Jewish Mafia Godfather.htm HTML File 3.4 KB Oct 1 2012 3:33 PM
mlk.pdf PDF Document 608.1 KB Oct 1 2012 3:32 PM
MLK101.pdf PDF Document 276.7 KB Oct 1 2012 3:33 PM
mlkday.pdf PDF Document 464.4 KB Oct 1 2012 3:33 PM
mlkflyer.pdf PDF Document 91.6 KB Oct 1 2012 3:30 PM
Mogadishu Redux -- The Irrepressible Genetics Of Simian Negroids.nws NWS File 111.1 KB Oct 1 2012 3:33 PM
Mom Gives Kids Dose O’ Diversity.htm HTML File 2.4 KB Oct 1 2012 3:31 PM
MoneyChangers.pdf PDF Document 172 KB Oct 1 2012 3:31 PM
More 'Racist' AIDS Statistics.htm HTML File 2.6 KB Oct 1 2012 3:31 PM
More Illegal Aliens Accused in Gang Rapes.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
More Jewish Mobsters Arriving.htm HTML File 7.7 KB Oct 1 2012 3:30 PM
morel.pdf PDF Document 342.2 KB Oct 1 2012 3:32 PM
More Legal Atrocities Against Serbian Whites.htm HTML File 9.5 KB Oct 1 2012 3:31 PM
Morell.pdf PDF Document 1.1 MB Oct 1 2012 3:31 PM
More on Reparations Unknown 18.8 KB Oct 1 2012 3:33 PM
More on the Cabbala.htm HTML File 7.9 KB Oct 1 2012 3:34 PM
More on the Orlando Sentinel's Campaign Against Free Speech and Thought.htm HTML File 7.4 KB Oct 1 2012 3:32 PM
MorrisDeesDivorcePapers.pdf PDF Document 33.4 KB Oct 1 2012 3:31 PM
MorrisDeesFactSheet.pdf PDF Document 203.1 KB Oct 1 2012 3:33 PM
MossadKillingMahcine.rtf RTF File 36.4 KB Oct 1 2012 3:28 PM
Mothers in Houston Join Katrina Altercation.htm HTML File 3.4 KB Oct 1 2012 3:31 PM
ms13_us.pdf PDF Document 295.9 KB Oct 1 2012 3:29 PM
MuadDib's Primer on the Jews.htm HTML File 71.9 KB Oct 1 2012 3:32 PM
Multicultural Jihad Wrecks Dutch Racial Harmony.htm HTML File 2.1 KB Oct 1 2012 3:27 PM
Multiracial Children Have More Psychological Problems.htm HTML File 4.4 KB Oct 1 2012 3:30 PM
Multiracialism and Conservatism.htm HTML File 21.3 KB Oct 1 2012 3:33 PM
mumiamurderer.pdf PDF Document 277.5 KB Oct 1 2012 3:31 PM
Museum Pulls 'Offensive' Artwork.htm HTML File 7.3 KB Oct 1 2012 3:34 PM
music.html HTML File 61.1 KB Oct 1 2012 3:33 PM
Muslim 'Tolerance' Boils Over in Egypt.htm HTML File 5.4 KB Oct 1 2012 3:31 PM
Muslims Back Down In Face of White 'Threat'.htm HTML File 6.5 KB Oct 1 2012 3:32 PM
My Big Biofuels Bet.htm HTML File 32.5 KB Oct 1 2012 3:34 PM
MY FAREWELL TO ISRAEL.htm HTML File 266.4 KB Oct 1 2012 3:31 PM
MyHonorIsLoyalty.pdf PDF Document 996.8 KB Oct 1 2012 3:31 PM
MyLifeOnThePlains.pdf PDF Document 732 KB Oct 1 2012 3:34 PM
Mystery of the mummies.htm HTML File 19.1 KB Oct 1 2012 3:30 PM
MythOfDiversity.pdf PDF Document 31 KB Oct 1 2012 3:31 PM
Myths, Misunderstandings, and Outright Lies - gold-confiscation-1933.htm HTML File 35.1 KB Oct 1 2012 3:31 PM
N.O. Cops Suspected of Stealing Up to 200 Cars.htm HTML File 3.8 KB Oct 1 2012 3:27 PM
Namibia, Africa - One Rape Every 60 Minutes.htm HTML File 1.9 KB Oct 1 2012 3:30 PM
Namibia - Tribe Demands German Reparations.htm HTML File 3.7 KB Oct 1 2012 3:33 PM
nascar.pdf PDF Document 60.5 KB Oct 1 2012 3:28 PM
Natallnews site.doc Microsoft Word Document 67 KB Oct 1 2012 3:31 PM
National Alliance Comic - Saga Of White Will.pdf PDF Document 17.2 MB Oct 1 2012 3:32 PM
National Alliance Speaks at Campus Mideast Forum.htm HTML File 10.2 KB Oct 1 2012 3:30 PM
National Vanguard - Just Say No to Illegal Immigrants.htm HTML File 9.2 KB Oct 1 2012 3:32 PM
National Vanguard Activist Wins Victory Against Censorship.htm HTML File 6.3 KB Oct 1 2012 3:31 PM
National Vanguard Magazine #129 - sample.pdf PDF Document 336.3 KB Oct 1 2012 3:33 PM
nationontrial.pdf PDF Document 540.4 KB Oct 1 2012 3:31 PM
nationontrial.rtf RTF File 290.6 KB Oct 1 2012 3:32 PM
NaturesEternalReligionOrig.pdf PDF Document 1.1 MB Oct 1 2012 3:28 PM
nazism - White Pride.htm HTML File 19.3 KB Oct 1 2012 3:31 PM
nc.photos.html HTML File 5.1 KB Oct 1 2012 3:31 PM
Nebilung.pdf PDF Document 491.8 KB Oct 1 2012 3:33 PM
Nebilung.rtf RTF File 598.8 KB Oct 1 2012 3:31 PM
Negro Accused of Spreading AIDS.htm HTML File 4 KB Oct 1 2012 3:32 PM
neonazi-chart.pdf PDF Document 69.6 KB Oct 1 2012 3:30 PM
ner.pdf PDF Document 1.1 MB Oct 1 2012 3:31 PM
Nerds Join Neo-Cons to Oppose National Vanguard.htm HTML File 4.5 KB Oct 1 2012 3:28 PM
Netherlands - Jihadi Plot Upsets Liberals.htm HTML File 3.2 KB Oct 1 2012 3:33 PM
Netherlands Braces for 'Jihad'.htm HTML File 2.1 KB Oct 1 2012 3:32 PM
nettinin04112006.html HTML File 113.3 KB Oct 1 2012 3:30 PM
New Africa.htm HTML File 4.4 KB Oct 1 2012 3:33 PM
NewAfricans.pdf PDF Document 35 KB Oct 1 2012 3:33 PM
New Book Helps White Families Become Prosperous.htm HTML File 2.9 KB Oct 1 2012 3:30 PM
New Charges for Lightfingers Tom.htm HTML File 2.9 KB Oct 1 2012 3:28 PM
New From FEMA - The Looter Relocation Program.htm HTML File 4.6 KB Oct 1 2012 3:31 PM
New Jersey - Jews Refuse to Vote in Churches.htm HTML File 7.5 KB Oct 1 2012 3:31 PM
New Jersey Girl Murdered and Dismembered By Mestizos.htm HTML File 3.1 KB Oct 1 2012 3:27 PM
New Jersey Icebergs and Whores.htm HTML File 24.8 KB Oct 1 2012 3:32 PM
New Jersey Rabbi Says Katrina Refugees Welcome in Utah.htm HTML File 3.2 KB Oct 1 2012 3:32 PM
New Orleans - Cops Join in Looting.htm HTML File 3.8 KB Oct 1 2012 3:29 PM
New Orleans - Second Amendment Suspended.htm HTML File 2.8 KB Oct 1 2012 3:32 PM
New Orleans - The Rise of 'Mighty Whitey'.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
New Orleans Africa-Like Well Before Hurricane Katrina.htm HTML File 5.1 KB Oct 1 2012 3:33 PM
New Orleans and 'The Gods of the Copybook Headings'.htm HTML File 27.3 KB Oct 1 2012 3:33 PM
New Orleans Chaos Reveals America on the Brink.htm HTML File 3.7 KB Oct 1 2012 3:31 PM
New Orleans Corrupt 'Down to the Bone,' Former Pol Charges.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
New Orleans Descends into Africa-like Savagery.htm HTML File 12.4 KB Oct 1 2012 3:33 PM
New Orleans gun confiscation is foolish and illegal.htm HTML File 7.2 KB Oct 1 2012 3:32 PM
New Orleans Parody Challenges System Media.htm HTML File 3.5 KB Oct 1 2012 3:34 PM
New Orleans Pays For Affirmative Action.htm HTML File 3.9 KB Oct 1 2012 3:32 PM
New Report Sheds Light on Hispanics in U.S..htm HTML File 3.8 KB Oct 1 2012 3:29 PM
New Sex Scandal Rocks Holy See.htm HTML File 5.2 KB Oct 1 2012 3:28 PM
Newsletter Sign Up.rar RAR Archive 601.2 KB Oct 1 2012 3:33 PM
newsletter_092005.pdf PDF Document 1.2 MB Oct 1 2012 3:28 PM
Newspaper Calls Mass-Murder 'Sad' Flier Distribution 'Despicable'.htm HTML File 4.3 KB Oct 1 2012 3:33 PM
Newsweek - Superlobbyist is Crooked.htm HTML File 2.8 KB Oct 1 2012 3:31 PM
New V-TV Video - Katrina Relief.htm HTML File 2.9 KB Oct 1 2012 3:33 PM
newyorkandhillaryschineserockets.html HTML File 4.9 KB Oct 1 2012 3:31 PM
New Yorkers to study about Israel.htm HTML File 14.9 KB Oct 1 2012 3:28 PM
New York Times - Chertoff Approved Abu Ghraib Interrogation Methods.htm HTML File 5.1 KB Oct 1 2012 3:33 PM
NFS_I.rar RAR Archive 89.9 MB Oct 1 2012 3:32 PM
Nick Griffin - The Race Murders the Media Ignore.htm HTML File 2.5 KB Oct 1 2012 3:32 PM
ninety_five_theses_on_the_holoca - Ninety Five Theses on the Holocaust.htm HTML File 35 KB Oct 1 2012 3:31 PM
NJ - Mestizo Cop Helped Drug Ring Say Officials.htm HTML File 4 KB Oct 1 2012 3:30 PM
NJ - New Black Panthers Come to Town.htm HTML File 4.4 KB Oct 1 2012 3:27 PM
NJ Ethics Office - Fagan Stole $400,000.htm HTML File 3.5 KB Oct 1 2012 3:33 PM
NJ Governor's Jewish Financial Angel - Also Clinton Backer, 'Holocaust' Appointee.htm HTML File 5.7 KB Oct 1 2012 3:28 PM
No, We're Not 'All Israelis Now'.htm HTML File 8.6 KB Oct 1 2012 3:28 PM
No Black Day in Jesse's Hometown.htm HTML File 4.1 KB Oct 1 2012 3:34 PM
No Debit Cards for White People.htm HTML File 2.4 KB Oct 1 2012 3:33 PM
noose.htm HTML File 11 KB Oct 1 2012 3:28 PM
Norman Language Flourishes in the Channel Islands.htm HTML File 5.8 KB Oct 1 2012 3:33 PM
North American Students Trained for 'Merger'.htm HTML File 4.1 KB Oct 1 2012 3:30 PM
Norway - 19,000 'Asylum' Seekers Evade Authorities.htm HTML File 2 KB Oct 1 2012 3:31 PM
Norwegian Patriots Demolish Sell-outs.htm HTML File 3.5 KB Oct 1 2012 3:31 PM
Norwegians Discover Joys of Islam.htm HTML File 2.7 KB Oct 1 2012 3:30 PM
Norwegian Teens Cool to 'Diversity'.htm HTML File 2.8 KB Oct 1 2012 3:30 PM
notes on Phenomenology.doc Microsoft Word Document 580 KB Oct 1 2012 3:31 PM
notguilty.pdf PDF Document 211.2 KB Oct 1 2012 3:33 PM
notguilty.rtf RTF File 142 KB Oct 1 2012 3:28 PM
Nov01.pdf PDF Document 909 KB Oct 1 2012 3:31 PM
Nov02.pdf PDF Document 1.8 MB Oct 1 2012 3:31 PM
Nov03.pdf PDF Document 871 KB Oct 1 2012 3:33 PM
Nov04.pdf PDF Document 634.2 KB Oct 1 2012 3:32 PM
nowarforisrael.pdf PDF Document 8.2 KB Oct 1 2012 3:32 PM
no_place_1.pdf PDF Document 802.2 KB Oct 1 2012 3:29 PM
nuremberg.pdf PDF Document 1.5 MB Oct 1 2012 3:30 PM
Nutty Professor Charged In Hate Crime Hoax.htm HTML File 4.2 KB Oct 1 2012 3:30 PM
nv_terrorfree.pdf PDF Document 571.3 KB Oct 1 2012 3:31 PM
nv_ussliberty.pdf PDF Document 156.3 KB Oct 1 2012 3:28 PM
nv_warforisrael.pdf PDF Document 113.9 KB Oct 1 2012 3:31 PM
NY Times Hit Hard as Controlled Media Take Continued Beating.htm HTML File 2.3 KB Oct 1 2012 3:31 PM
Oakland - Black-Yemeni Tension Ratcheted Up.htm HTML File 4.5 KB Oct 1 2012 3:28 PM
Oakland - Black Muslim Tensions Heightened.htm HTML File 7.5 KB Oct 1 2012 3:30 PM
Oakland - Blacks Loot Burned-Out Shell of Arab Store.htm HTML File 3.3 KB Oct 1 2012 3:27 PM
Oakland - Video Beating Victim Comes Forward.htm HTML File 3.3 KB Oct 1 2012 3:33 PM
Oakland Beating Video - Cops Baffled.htm HTML File 4 KB Oct 1 2012 3:30 PM
Oakland Update - Blacks Charged With Hate Crimes.htm HTML File 4.4 KB Oct 1 2012 3:28 PM
ocbpt.pdf PDF Document 3.3 MB Oct 1 2012 3:31 PM
ocbpt.rtf RTF File 5.8 MB Oct 1 2012 3:31 PM
ocbpt.zip ZIP Archive 3.5 MB Oct 1 2012 3:33 PM
Oct01.pdf PDF Document 905.4 KB Oct 1 2012 3:31 PM
Oct02.pdf PDF Document 1.4 MB Oct 1 2012 3:28 PM
Oct03.pdf PDF Document 1.1 MB Oct 1 2012 3:28 PM
Oct04.pdf PDF Document 705.3 KB Oct 1 2012 3:33 PM
October 7, 1571 - The Deliverance of Europe at Lepanto.htm HTML File 11 KB Oct 1 2012 3:30 PM
Of Course There Is an Israel Lobby.htm HTML File 3.1 KB Oct 1 2012 3:33 PM
Ohio - War Protest Turns Violent.htm HTML File 3.3 KB Oct 1 2012 3:27 PM
ohio college crime - 5349405.pdf PDF Document 30.3 KB Oct 1 2012 3:28 PM
ohn Lennon's 'Imagine' (revised).htm HTML File 7.5 KB Oct 1 2012 3:32 PM
Once We See Black We NEVER Go Back.htm HTML File 6 KB Oct 1 2012 3:31 PM
One Percent of Population Commits Half of Homicides.htm HTML File 120.4 KB Oct 1 2012 3:31 PM
OneSheaf.pdf PDF Document 549.2 KB Oct 1 2012 3:30 PM
On White Genocide.htm HTML File 11.8 KB Oct 1 2012 3:32 PM
opphack.htm HTML File 1.7 KB Oct 1 2012 3:31 PM
oppressed.pdf PDF Document 1.1 MB Oct 1 2012 3:31 PM
Optimized Krystal Planet Fall 2005 Catalog v3.pdf PDF Document 3.4 MB Oct 1 2012 3:33 PM
OriginsOfChristianity.pdf PDF Document 537.6 KB Oct 1 2012 3:31 PM
Over 75,000 AIDS Cases in New York City.htm HTML File 2.5 KB Oct 1 2012 3:33 PM
Pale Horsemen.pdf PDF Document 102.2 KB Oct 1 2012 3:27 PM
paleoamericanethnicdiversity.doc Microsoft Word Document 256 KB Oct 1 2012 3:33 PM
panels.pdf PDF Document 259.9 KB Oct 1 2012 3:31 PM
PassingOfGreatRace.pdf PDF Document 315.5 KB Oct 1 2012 3:33 PM
PassingOfTheGreatRace.rtf RTF File 438.5 KB Oct 1 2012 3:31 PM
Patric Ewing testifies he twice had oral sex at Gold Club.htm HTML File 28.7 KB Oct 1 2012 3:33 PM
Paul Jalsevac - The Inherent Racism Of Population Control.pdf PDF Document 380.7 KB Oct 1 2012 3:28 PM
Pay No Attention to the Jews Behind the Curtain—the Iron Curtain.htm HTML File 29.8 KB Oct 1 2012 3:28 PM
PC Desecration of Spanish Holy Site.htm HTML File 3.3 KB Oct 1 2012 3:33 PM
pearlharbor.pdf PDF Document 559 KB Oct 1 2012 3:27 PM
peltreport.pdf PDF Document 1.5 MB Oct 1 2012 3:33 PM
peltreport.rtf RTF File 2 MB Oct 1 2012 3:31 PM
Pennies.rtf RTF File 3.7 KB Oct 1 2012 3:34 PM
People Of Africa.pdf PDF Document 134.1 KB Oct 1 2012 3:33 PM
People Of Africa.zip ZIP Archive 29.1 KB Oct 1 2012 3:33 PM
Peterloo Massacre.htm HTML File 33.4 KB Oct 1 2012 3:32 PM
Petty Criminal Leaves Sarkozy Red-Faced.htm HTML File 3 KB Oct 1 2012 3:33 PM
Piezoelectric Windmill.pdf PDF Document 145.2 KB Oct 1 2012 3:29 PM
pipe.pdf PDF Document 1.6 MB Oct 1 2012 3:33 PM
pipermel.pdf PDF Document 1 MB Oct 1 2012 3:30 PM
Playstation Copying 4 Mac.pdf PDF Document 33.5 KB Oct 1 2012 3:28 PM
pledge.pdf PDF Document 722.5 KB Oct 1 2012 3:29 PM
Poignant Photo Strikes Reader.htm HTML File 2.7 KB Oct 1 2012 3:29 PM
PoisonousMushroom.pdf PDF Document 1 MB Oct 1 2012 3:30 PM
Poland Abruptly Cancels a Speech By Critic of the Jewish State.htm HTML File 3.2 KB Oct 1 2012 3:28 PM
Police - Hurricane Evacuees Kill Woman who Helped Them.htm HTML File 2.6 KB Oct 1 2012 3:31 PM
Police Demand Resignation of Black Commissioner.htm HTML File 2.3 KB Oct 1 2012 3:28 PM
Police Looting - Racial Realities Exposed in New Orleans.htm HTML File 4.6 KB Oct 1 2012 3:28 PM
Police Ordered to Stop Looters.htm HTML File 4.3 KB Oct 1 2012 3:31 PM
Polish-Americans Celebrate Harvest Festival.htm HTML File 3 KB Oct 1 2012 3:31 PM
Polish Father of US Cavalry Laid to Rest.htm HTML File 4.2 KB Oct 1 2012 3:30 PM
Political Correctness - The Scourge of Our Times.htm HTML File 3.9 KB Oct 1 2012 3:28 PM
Political Prisoners - In America.htm HTML File 8.3 KB Oct 1 2012 3:31 PM
Poll Shows Rising Tide of anti-Semitism on Eve of Holocaust Day.htm HTML File 3 KB Oct 1 2012 3:31 PM
Polls Show Opposition to Iraq War at All-Time High.htm HTML File 3.4 KB Oct 1 2012 3:30 PM
poster1470.jpg JPEG Image 113.1 KB Oct 1 2012 3:32 PM
Powerful Gains For Pro-Whites in Norwegian Elections.htm HTML File 3.3 KB Oct 1 2012 3:31 PM
Pre-Traumatic Stress Disorder-A Glimpse Into Israeli Collective Psychosis.htm HTML File 31.1 KB Oct 1 2012 3:34 PM
President Putin - 'Orthodox Christianity an Integral Part of Russian Culture'.htm HTML File 2 KB Oct 1 2012 3:28 PM
Pressure on Chertoff Builds.htm HTML File 3.1 KB Oct 1 2012 3:33 PM
Principal Negative Stereotypes Against European Americans.htm HTML File 7.4 KB Oct 1 2012 3:32 PM
printer.php.htm HTML File 5.2 KB Oct 1 2012 3:30 PM
prison_camps.pdf PDF Document 774.5 KB Oct 1 2012 3:31 PM
Pro-Zionist Televangelist Advocates Murder.htm HTML File 4.4 KB Oct 1 2012 3:32 PM
Pro and Con - NFL Star Allegedly Runs Over Teens in Stolen Car.htm HTML File 3.3 KB Oct 1 2012 3:28 PM
Progress Party Gets It Right.htm HTML File 2.7 KB Oct 1 2012 3:32 PM
Prophecy of the Seeress.htm HTML File 42 KB Oct 1 2012 3:31 PM
Protestants and Catholics Unite -- For a Brown Ireland.htm HTML File 3.9 KB Oct 1 2012 3:32 PM
Protests Loom in Far West, Washington.htm HTML File 3.7 KB Oct 1 2012 3:31 PM
ProtocolsOfZion.pdf PDF Document 215.8 KB Oct 1 2012 3:31 PM
PRreal.pdf PDF Document 446.3 KB Oct 1 2012 3:31 PM
Prussian Blue and the First Amendment.htm HTML File 8.1 KB Oct 1 2012 3:29 PM
PrussianismAndSocialism.pdf PDF Document 191.3 KB Oct 1 2012 3:34 PM
PUB637.pdf PDF Document 232.8 KB Oct 1 2012 3:29 PM
puddingrecipe .pdf PDF Document 1.2 MB Oct 1 2012 3:32 PM
Purchasing Precious Metals.htm HTML File 105.7 KB Oct 1 2012 3:29 PM
Putin's Cannibals 'Gaffe'.htm HTML File 2.5 KB Oct 1 2012 3:32 PM
Putin, the Patriot.htm HTML File 2.3 KB Oct 1 2012 3:29 PM
Putin - Those Who Bombed Serbia Should Pay Damages.htm HTML File 3 KB Oct 1 2012 3:33 PM
Putin Pilgrimage Strengthens Greco-Russian Links.htm HTML File 3.9 KB Oct 1 2012 3:28 PM
putting_israel_first.pdf PDF Document 1.1 MB Oct 1 2012 3:28 PM
QueenIsabella.pdf PDF Document 875.1 KB Oct 1 2012 3:31 PM
QueenIsabella.rtf RTF File 350.7 KB Oct 1 2012 3:34 PM
Questions of Preferential Treatment Raised in Sex Case.htm HTML File 4.2 KB Oct 1 2012 3:33 PM
Questions That May Not Be Asked About New Orleans.htm HTML File 4.5 KB Oct 1 2012 3:34 PM
QuotesAboutJews.pdf PDF Document 1.2 MB Oct 1 2012 3:33 PM
Rabbi calls for extermination of all Palestinian males.htm HTML File 5 KB Oct 1 2012 3:32 PM
Rabbis to Israeli Military - Kill More Non-Jews.htm HTML File 6.9 KB Oct 1 2012 3:33 PM
Race-based Medicine Confirms Genetic Differences.htm HTML File 2.5 KB Oct 1 2012 3:30 PM
race-mixing1.pdf PDF Document 856.4 KB Oct 1 2012 3:28 PM
Race and Murder.htm HTML File 5.3 KB Oct 1 2012 3:34 PM
Race Baiting as New Orleans Sinks.htm HTML File 6.4 KB Oct 1 2012 3:32 PM
racebook.doc Microsoft Word Document 683 KB Oct 1 2012 3:34 PM
RaceBook2.doc Microsoft Word Document 817.5 KB Oct 1 2012 3:31 PM
RaceEvolutionBehavior.pdf PDF Document 1.2 MB Oct 1 2012 3:31 PM
Race Hated - What Drives Jews.htm HTML File 8.8 KB Oct 1 2012 3:31 PM
Race in Ancient Egypt.htm HTML File 2.1 KB Oct 1 2012 3:33 PM
RaceMythsFromLeft.pdf PDF Document 39.7 KB Oct 1 2012 3:29 PM
RaceOfAncientEgypt.pdf PDF Document 258.8 KB Oct 1 2012 3:31 PM
Race_Evolution_Behavior.pdf PDF Document 2.7 MB Oct 1 2012 3:31 PM
race_traitor.pdf PDF Document 1.3 MB Oct 1 2012 3:28 PM
RachelCorrie.pdf PDF Document 129.4 KB Oct 1 2012 3:31 PM
Racial Battle-Lines Divide School.htm HTML File 3.5 KB Oct 1 2012 3:28 PM
Racial Explosion 60 Years On.htm HTML File 24.3 KB Oct 1 2012 3:29 PM
racialgapinschoolssplitsatownproudofdiversity.html HTML File 16.3 KB Oct 1 2012 3:32 PM
racialgapremainswideonmcasscores.html HTML File 9.1 KB Oct 1 2012 3:33 PM
Racialism versus Communitarianism.htm HTML File 25.8 KB Oct 1 2012 3:32 PM
Racial Media Jump on Katrina News.htm HTML File 3.6 KB Oct 1 2012 3:28 PM
RacialOriginOfJews.pdf PDF Document 51.7 KB Oct 1 2012 3:28 PM
Racial Reality and the New Orleans Nightmare.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
Racial Test Gap Remains Large in California.htm HTML File 2.6 KB Oct 1 2012 3:33 PM
Rad-ad.pdf PDF Document 123.4 KB Oct 1 2012 3:27 PM
Radical White Intellectual Predicts World-Altering Tempest.htm HTML File 9.8 KB Oct 1 2012 3:29 PM
Radio Station Urges 'Kill Tookie' Emails to Schwarzenegger.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
raffle2005.pdf PDF Document 451.1 KB Oct 1 2012 3:31 PM
rahowa.pdf PDF Document 1 MB Oct 1 2012 3:29 PM
Ramadan Madness Looms.htm HTML File 4.3 KB Oct 1 2012 3:28 PM
Rap King Shot in Florida.htm HTML File 3.2 KB Oct 1 2012 3:31 PM
Ravage_1.pdf PDF Document 445.8 KB Oct 1 2012 3:31 PM
Ravage_2.pdf PDF Document 654.7 KB Oct 1 2012 3:28 PM
READ-DavidLane's final addr.PDF PDF Document 21.5 KB Oct 1 2012 3:34 PM
Reading, Writing and Race.htm HTML File 230.1 KB Oct 1 2012 3:28 PM
README Open Letter- English.PDF PDF Document 20.8 KB Oct 1 2012 3:32 PM
Real Racial Supremacism.htm HTML File 24.3 KB Oct 1 2012 3:28 PM
Recent Events Show America is Changing.htm HTML File 3.9 KB Oct 1 2012 3:32 PM
Reflections Dental.rtf RTF File 3.1 KB Oct 1 2012 3:31 PM
Refugee Numbers On the Rise.htm HTML File 2.1 KB Oct 1 2012 3:33 PM
Religious Group Flagellate Selves Over 'Reparations'.htm HTML File 7.2 KB Oct 1 2012 3:28 PM
Remember the Turkish Genocide of the Pontic Greeks.htm HTML File 6.2 KB Oct 1 2012 3:33 PM
renaissance.html HTML File 41.5 KB Oct 1 2012 3:27 PM
Renewable Energy Home Products Brochure.pdf PDF Document 935.5 KB Oct 1 2012 3:28 PM
Report - Cannibalism in New Orleans.htm HTML File 2.7 KB Oct 1 2012 3:32 PM
reportblackslikelytobespecialedstudents.html HTML File 1.6 KB Oct 1 2012 3:27 PM
Report Illegal Aliens - status_report.htm HTML File 39.5 KB Oct 1 2012 3:32 PM
Republicans Back Pro-Homosexual 'Hate Crimes' Expansion.htm HTML File 3.4 KB Oct 1 2012 3:30 PM
resistancetoday.htm HTML File 80.2 KB Oct 1 2012 3:34 PM
Resisting Defamation - Principal Negative Stereotypes Against European Americans.htm HTML File 1.7 KB Oct 1 2012 3:31 PM
Resisting Defamatory Anti-White Language.htm HTML File 15.9 KB Oct 1 2012 3:31 PM
Restaurant Owner_ NOT GUILTY for squishing savage Shantavious!.nws NWS File 2.1 KB Oct 1 2012 3:33 PM
Restoring The Small Farm.htm HTML File 55.5 KB Oct 1 2012 3:27 PM
RESULTS OF MINNESOTA TRANSRACIAL ADOPTION STUDY.htm HTML File 9.9 KB Oct 1 2012 3:32 PM
RethinkingImmigration.pdf PDF Document 305.8 KB Oct 1 2012 3:34 PM
RevisionismConsequences.pdf PDF Document 200.9 KB Oct 1 2012 3:31 PM
revisionistpamphlets.pdf PDF Document 481.4 KB Oct 1 2012 3:31 PM
revisionistpamphlets.rtf RTF File 354.8 KB Oct 1 2012 3:30 PM
RevoltAgainstCivilization.pdf PDF Document 488.6 KB Oct 1 2012 3:33 PM
RFP_SFP-App.pdf PDF Document 679.1 KB Oct 1 2012 3:31 PM
Rhode Island - Cops Catch Illegals at Dem Chair's House.htm HTML File 2.9 KB Oct 1 2012 3:33 PM
RightAndWrongRacism.pdf PDF Document 43 KB Oct 1 2012 3:28 PM
rights.pdf PDF Document 47.5 KB Oct 1 2012 3:27 PM
RisingTideOfColor.pdf PDF Document 545.1 KB Oct 1 2012 3:29 PM
RitualMurderInvestigation.pdf PDF Document 4.3 MB Oct 1 2012 3:30 PM
RitualMurderMythOrReality.pdf PDF Document 245.9 KB Oct 1 2012 3:32 PM
Robert S. Griffin - 2004-09-05 - William Pierce - A Reminiscence.htm HTML File 34.4 KB Oct 1 2012 3:34 PM
RoboticsUIUC_CropProtectionConf.pdf PDF Document 494 KB Oct 1 2012 3:33 PM
Rockers Demand Recognition of Armenian Genocide.htm HTML File 7.2 KB Oct 1 2012 3:30 PM
Rommel.pdf PDF Document 4.8 MB Oct 1 2012 3:32 PM
Rosa Brooks - Criticize Israel - You're an Anti-Semite.htm HTML File 45.1 KB Oct 1 2012 3:28 PM
RosenbergMemoirs.pdf PDF Document 705.2 KB Oct 1 2012 3:33 PM
rtc_1-01.html HTML File 21.5 KB Oct 1 2012 3:30 PM
rtc_1-02.html HTML File 57.9 KB Oct 1 2012 3:33 PM
rtc_1-03.html HTML File 51 KB Oct 1 2012 3:33 PM
rtc_1-04.html HTML File 26.1 KB Oct 1 2012 3:31 PM
rtc_1-05.html HTML File 61 KB Oct 1 2012 3:28 PM
rtc_2-06.html HTML File 13 KB Oct 1 2012 3:28 PM
rtc_2-07.html HTML File 29.4 KB Oct 1 2012 3:30 PM
rtc_2-08.html HTML File 37.4 KB Oct 1 2012 3:30 PM
rtc_2-09.html HTML File 37.5 KB Oct 1 2012 3:28 PM
rtc_3-10.html HTML File 17.2 KB Oct 1 2012 3:28 PM
rtc_3-11.html HTML File 96.7 KB Oct 1 2012 3:32 PM
rtc_3-12.html HTML File 17.8 KB Oct 1 2012 3:33 PM
rtc_intro.html HTML File 22.2 KB Oct 1 2012 3:28 PM
rtc_preface.html HTML File 4.5 KB Oct 1 2012 3:32 PM
RulesForLivingWithPeople.pdf PDF Document 16.7 KB Oct 1 2012 3:29 PM
Rural Traditions of the Pennsylvania Dutch Still Strong.htm HTML File 4.9 KB Oct 1 2012 3:32 PM
Rush-un.pdf PDF Document 82 KB Oct 1 2012 3:32 PM
Russia - Jewish Group Worried About Russian Patriots.htm HTML File 3.3 KB Oct 1 2012 3:33 PM
Russia - Sophisticated Sex Slave Operation Uncovered.htm HTML File 6.1 KB Oct 1 2012 3:33 PM
Russian State Duma Denounces Armenian Genocide.htm HTML File 2.1 KB Oct 1 2012 3:28 PM
Russian Wealth in Hands of Jews - One Hundred Own Quarter of Wealth as Russians Starve.htm HTML File 6.8 KB Oct 1 2012 3:31 PM
Russia Ponders Tax on Childlessness.htm HTML File 3.1 KB Oct 1 2012 3:32 PM
rvtr.pdf PDF Document 929.6 KB Oct 1 2012 3:33 PM
rwp_06_011_walt.pdf PDF Document 1.2 MB Oct 1 2012 3:29 PM
sacred_cavern.zip ZIP Archive 422.5 KB Oct 1 2012 3:31 PM
SaddestStory.pdf PDF Document 7.2 KB Oct 1 2012 3:30 PM
sales.html HTML File 30.1 KB Oct 1 2012 3:31 PM
San Diego Whites Protest Ethnic Cleansing.htm HTML File 3.2 KB Oct 1 2012 3:33 PM
Sarah_Knox_Taylor_davis.pdf PDF Document 24.1 KB Oct 1 2012 3:31 PM
SATGapBW.pdf PDF Document 314.9 KB Oct 1 2012 3:31 PM
Savages.pdf PDF Document 987.5 KB Oct 1 2012 3:34 PM
savitri-pdf.zip ZIP Archive 1.3 MB Oct 1 2012 3:33 PM
saynotoextinction.pdf PDF Document 25.9 KB Oct 1 2012 3:29 PM
scamway.pdf PDF Document 1.7 MB Oct 1 2012 3:29 PM
School Officials Look the Other Way When Whites are Abused.htm HTML File 7.5 KB Oct 1 2012 3:29 PM
schoolsfacecivilrightsprobe.html HTML File 5.9 KB Oct 1 2012 3:28 PM
Science Strikes Back.htm HTML File 86.9 KB Oct 1 2012 3:31 PM
Scotland - Poseurs Headed for Kneecapping.htm HTML File 6 KB Oct 1 2012 3:32 PM
Scotland - Race Killing Case Opens.htm HTML File 3.3 KB Oct 1 2012 3:33 PM
Seattle Test Scores Anguish.htm HTML File 2.6 KB Oct 1 2012 3:28 PM
secondchance.pdf PDF Document 130.4 KB Oct 1 2012 3:30 PM
Secret Service agents say Cheney was drunk when he shot lawyer.htm HTML File 7.4 KB Oct 1 2012 3:33 PM
SecretsOfFedReserve.pdf PDF Document 461.2 KB Oct 1 2012 3:28 PM
security_911_2005color.pdf PDF Document 216 KB Oct 1 2012 3:30 PM
send_the_goyim.pdf PDF Document 843.6 KB Oct 1 2012 3:29 PM
Sep01.pdf PDF Document 1.4 MB Oct 1 2012 3:28 PM
Sep02.pdf PDF Document 1.6 MB Oct 1 2012 3:33 PM
Sep03.pdf PDF Document 675.9 KB Oct 1 2012 3:34 PM
Sep04.pdf PDF Document 558.9 KB Oct 1 2012 3:34 PM
Sex Offenders Slip Radar.htm HTML File 2.1 KB Oct 1 2012 3:28 PM
Sex Rabbi - 'I'll Debate David Duke'.htm HTML File 2.8 KB Oct 1 2012 3:28 PM
Sex Trade Flourishing in 'Holy Land'.htm HTML File 2 KB Oct 1 2012 3:31 PM
shadow.pdf PDF Document 632.6 KB Oct 1 2012 3:30 PM
shakedown2.pdf PDF Document 1 MB Oct 1 2012 3:30 PM
shamiressays.pdf PDF Document 875.8 KB Oct 1 2012 3:29 PM
shamiressays.rtf RTF File 1018.3 KB Oct 1 2012 3:33 PM
Sharon - The Al Sharpton of the Middle East.htm HTML File 5.8 KB Oct 1 2012 3:31 PM
ShatteringMythOfRacism.pdf PDF Document 1.6 MB Oct 1 2012 3:28 PM
Shaun Walker - What Happened to Normal Behavior - 10-08-2005.pdf PDF Document 247.3 KB Oct 1 2012 3:33 PM
shelby - Terrorism In South Africa.htm HTML File 17.3 KB Oct 1 2012 3:28 PM
shirts.html HTML File 17.6 KB Oct 1 2012 3:32 PM
Shmuley loses it.htm HTML File 34.2 KB Oct 1 2012 3:30 PM
shongum_001-020.doc Microsoft Word Document 788 KB Oct 1 2012 3:32 PM
shongum_021-050.doc Microsoft Word Document 343 KB Oct 1 2012 3:27 PM
shongum_051-070.doc Microsoft Word Document 493.5 KB Oct 1 2012 3:28 PM
shongum_071-096.doc Microsoft Word Document 323 KB Oct 1 2012 3:31 PM
shongum_097-122.doc Microsoft Word Document 228.5 KB Oct 1 2012 3:33 PM
shongum_123-150.doc Microsoft Word Document 786 KB Oct 1 2012 3:28 PM
shongum_151-168.doc Microsoft Word Document 552 KB Oct 1 2012 3:27 PM
shongum_BIBLIOG_REFS.doc Microsoft Word Document 20.5 KB Oct 1 2012 3:30 PM
shongum_preface.doc Microsoft Word Document 332.5 KB Oct 1 2012 3:31 PM
shongum_preface.xhtml HTML File 26.2 KB Oct 1 2012 3:28 PM
shufeldt.pdf PDF Document 4.9 MB Oct 1 2012 3:29 PM
sikorski.pdf PDF Document 937.3 KB Oct 1 2012 3:31 PM
SilentJew.pdf PDF Document 35.1 KB Oct 1 2012 3:28 PM
Silver - Why You Should Own It.htm HTML File 5.9 KB Oct 1 2012 3:31 PM
SimpleArithmetic.pdf PDF Document 14.6 KB Oct 1 2012 3:33 PM
Singapore Bloggers Latest Victims of Multicultural Intolerance.htm HTML File 3.6 KB Oct 1 2012 3:31 PM
Sinn Fein Touts for Third World Ireland at Westminster.htm HTML File 6.2 KB Oct 1 2012 3:31 PM
Sir Gawain and the Green Knight - Indo-European Archetypal Myth.htm HTML File 20.1 KB Oct 1 2012 3:27 PM
sl.pdf PDF Document 1 MB Oct 1 2012 3:34 PM
Slave Account - Fiction.htm HTML File 3.3 KB Oct 1 2012 3:30 PM
SlaveryWhatReallyHappened.pdf PDF Document 22.1 KB Oct 1 2012 3:31 PM
SmartFractionTheory.pdf PDF Document 77.7 KB Oct 1 2012 3:31 PM
smash.pdf PDF Document 55.5 KB Oct 1 2012 3:31 PM
smell_the_blood.pdf PDF Document 846.5 KB Oct 1 2012 3:33 PM
SocialDarwinism.pdf PDF Document 15.7 KB Oct 1 2012 3:27 PM
SocratesVsJesus.pdf PDF Document 104.5 KB Oct 1 2012 3:34 PM
So Long Tookie.htm HTML File 6 KB Oct 1 2012 3:34 PM
solzhenitsyn photo.jpg JPEG Image 14.4 KB Oct 1 2012 3:30 PM
Some Comments on 'Racism'.htm HTML File 6.3 KB Oct 1 2012 3:33 PM
Some Jews Still Attacking Mel Gibson.htm HTML File 5 KB Oct 1 2012 3:28 PM
Soros 'An Extremely Evil Person'.htm HTML File 2.9 KB Oct 1 2012 3:27 PM
So You Think You're a White Anti-Racist.htm HTML File 6.1 KB Oct 1 2012 3:29 PM
So You Thought the Mob Was Run by Italians.htm HTML File 18.1 KB Oct 1 2012 3:28 PM
SP27.pdf PDF Document 159 Bytes Oct 1 2012 3:34 PM
specialtreatment.pdf PDF Document 6.8 MB Oct 1 2012 3:27 PM
Specific Sites Excluded from Google.fr and or Google.de.htm HTML File 58.3 KB Oct 1 2012 3:31 PM
Spelling Used TV to Push Homosexual Agenda.htm HTML File 5.1 KB Oct 1 2012 3:28 PM
spiderjew.jpg JPEG Image 6.9 KB Oct 1 2012 3:34 PM
Spoof - Byzantine Emperor Apologizes to Muslims For Quote.htm HTML File 4.3 KB Oct 1 2012 3:31 PM
srebrenica.pdf PDF Document 15.1 MB Oct 1 2012 3:30 PM
ssracetheory.pdf PDF Document 2.7 MB Oct 1 2012 3:29 PM
St. George and the Harridan.htm HTML File 5.2 KB Oct 1 2012 3:33 PM
St. Petersburg, FL - ethnic.htm HTML File 22.9 KB Oct 1 2012 3:34 PM
Stab in the Back - Israel’s Attack on the USS Liberty.htm HTML File 10.3 KB Oct 1 2012 3:31 PM
Stalin’s Willing Executioners - 2005-11-05.txt Text File 22.8 KB Oct 1 2012 3:32 PM
Stalin’s Willing Executioners.txt Text File 37 KB Oct 1 2012 3:31 PM
Stanford - Racial Groupings Match Genetic Profiles.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
State Dept. Provides Preview of Life in Aztlan.htm HTML File 24 KB Oct 1 2012 3:29 PM
stayawayfromblackdoctors.html HTML File 5.1 KB Oct 1 2012 3:32 PM
Steve E Romer - 2006-04-18 - Make Illegal Aliens Felons - That's Not Enough.htm HTML File 23.6 KB Oct 1 2012 3:28 PM
Steven E. Roper - 2003-10-04 - Beyond IQ.txt Text File 9.3 KB Oct 1 2012 3:33 PM
Steven E. Roper - 2004-12-11 - White People's Music; White People's Religion.txt Text File 18.3 KB Oct 1 2012 3:31 PM
Steven E Romer - 2006-02-14 - Tiny Differences, Through Time, are Everything.htm HTML File 30.2 KB Oct 1 2012 3:28 PM
Stopping the Unstoppable.htm HTML File 23.8 KB Oct 1 2012 3:33 PM
Stop White Genocide.htm HTML File 26.6 KB Oct 1 2012 3:31 PM
StrangeLifeOfNikolaTesla.pdf PDF Document 284.3 KB Oct 1 2012 3:30 PM
Strangers Among Us.htm HTML File 55.6 KB Oct 1 2012 3:34 PM
Strong Showing for BNP.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
stupidwhitemen.pdf PDF Document 1.4 MB Oct 1 2012 3:27 PM
stylesheet.css Stylesheet 5.1 KB Oct 1 2012 3:31 PM
Subverting the Disney Legacy - Michael Eisner.htm HTML File 16.3 KB Oct 1 2012 3:30 PM
Supermob - Sidney Korshak and His Criminal Associates.htm HTML File 5 KB Oct 1 2012 3:29 PM
Support Freedom of Speech - Wear the Wristband.htm HTML File 5 KB Oct 1 2012 3:33 PM
Surrounded by Jews, Bush Blasts Mahathir, Says He's 'Wrong' About Jewish Power.htm HTML File 3.3 KB Oct 1 2012 3:28 PM
Survey - Israel is Number One Threat to World Peace.htm HTML File 5.8 KB Oct 1 2012 3:31 PM
Suspect - My Job Is 'Taking White People's Cars'.htm HTML File 11.5 KB Oct 1 2012 3:32 PM
Sustainable_Design_Goals.pdf PDF Document 485.6 KB Oct 1 2012 3:31 PM
swazi.ttf TTF File 46.1 KB Oct 1 2012 3:32 PM
Swedes Arrest Alleged 'Anti-Fascist' Terrorist.htm HTML File 3.8 KB Oct 1 2012 3:34 PM
Swedes Embrace Inquisition.htm HTML File 4.6 KB Oct 1 2012 3:27 PM
Swiss Banks and the Jews - What Happened to the Extra Billion.htm HTML File 11.9 KB Oct 1 2012 3:28 PM
Synagogue Desecration Shocks London.htm HTML File 7.3 KB Oct 1 2012 3:31 PM
Syrians Snuff Islamist Attack on US.htm HTML File 4.5 KB Oct 1 2012 3:28 PM
t.zip ZIP Archive 2.1 MB Oct 1 2012 3:34 PM
Take Me to Your Moron.htm HTML File 4.8 KB Oct 1 2012 3:28 PM
TakeYourChoice.pdf PDF Document 575.2 KB Oct 1 2012 3:31 PM
TaliessinThroughLoegres.pdf PDF Document 96.8 KB Oct 1 2012 3:28 PM
Tampa - When Whites Gather.htm HTML File 7.5 KB Oct 1 2012 3:30 PM
Tampa Summer Solstice Festival.htm HTML File 2.6 KB Oct 1 2012 3:34 PM
Targetmaster.pdf PDF Document 27.8 KB Oct 1 2012 3:32 PM
TaxonomicConstruct.pdf PDF Document 341.1 KB Oct 1 2012 3:33 PM
teachertestshowswideracialgap.html HTML File 6.3 KB Oct 1 2012 3:30 PM
Television Pioneer Elma Farnsworth Dies at 98.htm HTML File 9.5 KB Oct 1 2012 3:31 PM
TerrorFree.pdf PDF Document 505.3 KB Oct 1 2012 3:31 PM
testscoreprobesought.html HTML File 6.4 KB Oct 1 2012 3:30 PM
Texas Papers Play Up 'Racial' Quotes by Candidate Friedman.htm HTML File 2.8 KB Oct 1 2012 3:30 PM
TextbookOfTheUniverse.pdf PDF Document 12.3 MB Oct 1 2012 3:33 PM
tfh.pdf PDF Document 3.7 MB Oct 1 2012 3:30 PM
tfh.zip ZIP Archive 2.4 MB Oct 1 2012 3:30 PM
That Which is Good, Shall be Called Evil.htm HTML File 9.3 KB Oct 1 2012 3:33 PM
thcov.pdf PDF Document 812.1 KB Oct 1 2012 3:28 PM
The 'Holocaust' Is A Typical Zionist Myth.htm HTML File 49 KB Oct 1 2012 3:28 PM
THE 100% SOLUTION.pdf PDF Document 85.7 KB Oct 1 2012 3:28 PM
The ADL, Jesus, and Anti-Semitism.htm HTML File 4.3 KB Oct 1 2012 3:33 PM
The American Nation.htm HTML File 19.4 KB Oct 1 2012 3:31 PM
The American Nation Part II.htm HTML File 17.5 KB Oct 1 2012 3:34 PM
The Anthrax Murders - The Israeli Connection, part 1.htm HTML File 25 KB Oct 1 2012 3:31 PM
The Anthrax Murders - The Israeli Connection, part 2.htm HTML File 23.6 KB Oct 1 2012 3:32 PM
The Anti-White Gangsters of Ulster.htm HTML File 4.4 KB Oct 1 2012 3:28 PM
TheAntichrist.pdf PDF Document 164.5 KB Oct 1 2012 3:32 PM
THE ARYANS, OR NOBLES.htm HTML File 11.2 KB Oct 1 2012 3:34 PM
The Barack Obama Myth.htm HTML File 7.5 KB Oct 1 2012 3:28 PM
The BBC's One Way Racism.htm HTML File 3.3 KB Oct 1 2012 3:33 PM
The Beast as Saint - The Truth About 'Martin Luther King'.htm HTML File 22.8 KB Oct 1 2012 3:33 PM
The Biological Puzzle of Jewish Behavior.htm HTML File 12.2 KB Oct 1 2012 3:30 PM
The Broken Wall - newspaper coverage of its advertisers.txt Text File 23.9 KB Oct 1 2012 3:29 PM
thecause.pdf PDF Document 166 KB Oct 1 2012 3:29 PM
The Changing Face of AIDS.htm HTML File 17.8 KB Oct 1 2012 3:32 PM
THE CHINK IN OUR ARMOR.htm HTML File 19.9 KB Oct 1 2012 3:30 PM
The Christ-Killers Today.htm HTML File 22 KB Oct 1 2012 3:32 PM
The Color Of Crime And The New Orleans Nightmare.htm HTML File 13.2 KB Oct 1 2012 3:27 PM
TheComingBattle.pdf PDF Document 728.1 KB Oct 1 2012 3:30 PM
The Confederate Defeat, The Fall Of New Orleans.htm HTML File 44 KB Oct 1 2012 3:31 PM
The Congo's Atrocious Secret.htm HTML File 2.1 KB Oct 1 2012 3:34 PM
thecoxreport.html HTML File 10 KB Oct 1 2012 3:33 PM
The Darkening Face of AIDS.htm HTML File 1.7 KB Oct 1 2012 3:34 PM
The Dark Side of the Anti-Defamation League, part 1.htm HTML File 4.3 KB Oct 1 2012 3:31 PM
The Dark Side of the Anti-Defamation League, part 2.htm HTML File 3.2 KB Oct 1 2012 3:30 PM
The Dark Side of the Anti-Defamation League, part 3.htm HTML File 3.2 KB Oct 1 2012 3:33 PM
The Dark Side of the Anti-Defamation League, part 4.htm HTML File 3.3 KB Oct 1 2012 3:33 PM
The Dark Side of the Anti-Defamation League, part 5.htm HTML File 3.9 KB Oct 1 2012 3:28 PM
The Dark Side of the Anti-Defamation League, part 6.htm HTML File 3.7 KB Oct 1 2012 3:33 PM
The Dark Side of the Anti-Defamation League, part 7.htm HTML File 4.2 KB Oct 1 2012 3:31 PM
The Dark Side of the Anti-Defamation League, part 8.htm HTML File 3.9 KB Oct 1 2012 3:34 PM
The De-Zionization of the American Mind.htm HTML File 3.7 KB Oct 1 2012 3:30 PM
The Deadly Twins.htm HTML File 10.8 KB Oct 1 2012 3:33 PM
The Destruction of White Youth.htm HTML File 3 KB Oct 1 2012 3:33 PM
The Dog Gone Asians.htm HTML File 4.6 KB Oct 1 2012 3:31 PM
The Drunken Truth.htm HTML File 18 KB Oct 1 2012 3:30 PM
The Dutch Say 'Nee!'.htm HTML File 4.8 KB Oct 1 2012 3:28 PM
The Eternal Value of Privacy.htm HTML File 24.5 KB Oct 1 2012 3:30 PM
The EU Constitution.htm HTML File 6 KB Oct 1 2012 3:27 PM
The Evidence of the Prussian Blue.htm HTML File 14.5 KB Oct 1 2012 3:31 PM
The Factory Farms of Jewish Publishing.htm HTML File 14.8 KB Oct 1 2012 3:30 PM
The FCC Scandal.htm HTML File 3.8 KB Oct 1 2012 3:27 PM
The Forbidden Srebrenica Report - Something The Neo-cons Don't Want You To See.htm HTML File 3.9 KB Oct 1 2012 3:32 PM
The Fraud of Neoconservative 'Anti-Communism'.htm HTML File 19.4 KB Oct 1 2012 3:32 PM
The Gateway.htm HTML File 19.6 KB Oct 1 2012 3:31 PM
The Governors Declare An Emergency - Who Cares If They’re Sincere.htm HTML File 3.2 KB Oct 1 2012 3:29 PM
The Hard Edge of Hatred.htm HTML File 11 KB Oct 1 2012 3:32 PM
The Hidden History of 9-11-2001.htm HTML File 129.8 KB Oct 1 2012 3:28 PM
The Hidden Tyranny.txt Text File 49.5 KB Oct 1 2012 3:28 PM
THE HIGH COST OF VENGEANCE.rtf RTF File 906.3 KB Oct 1 2012 3:33 PM
The Hollywood Big Lie.htm HTML File 5.9 KB Oct 1 2012 3:28 PM
The Holocaust Controversy - The Case For Open Debate.htm HTML File 20.8 KB Oct 1 2012 3:33 PM
The Holy Man and the Ho.htm HTML File 4.8 KB Oct 1 2012 3:27 PM
TheInternationalJew.pdf PDF Document 2.4 MB Oct 1 2012 3:30 PM
TheJewAsCriminal.pdf PDF Document 511.8 KB Oct 1 2012 3:31 PM
The Jewish Declaration of War.htm HTML File 33.2 KB Oct 1 2012 3:31 PM
THE JEWS AND THE CONCENTRATION CAMPS - A FACTUAL APPRAISAL BY THE RED.htm HTML File 16.2 KB Oct 1 2012 3:30 PM
The Jew Who Fled Rio.htm HTML File 18.5 KB Oct 1 2012 3:34 PM
The Judas Goats.htm HTML File 31.6 KB Oct 1 2012 3:31 PM
TheJungle.pdf PDF Document 815.9 KB Oct 1 2012 3:32 PM
The Kwanzaa Hoax.htm HTML File 13.1 KB Oct 1 2012 3:32 PM
The Last Straw - Jewish Death Squads in America.htm HTML File 18.1 KB Oct 1 2012 3:31 PM
The Leo Frank case.htm HTML File 56.9 KB Oct 1 2012 3:31 PM
The Liberty Tree.htm HTML File 6 KB Oct 1 2012 3:31 PM
The Love of Ages.htm HTML File 21.9 KB Oct 1 2012 3:31 PM
The Meaning of the Candy Cane.txt Text File 468 Bytes Oct 1 2012 3:31 PM
The Middle East Initiative.htm HTML File 18.3 KB Oct 1 2012 3:29 PM
The Missiles at Ground Zero.htm HTML File 20.8 KB Oct 1 2012 3:31 PM
The Most Corrupt Member of Congress.htm HTML File 2.3 KB Oct 1 2012 3:31 PM
The Neo-Genocidists.htm HTML File 15.2 KB Oct 1 2012 3:34 PM
The New Minority.htm HTML File 4.9 KB Oct 1 2012 3:28 PM
The Next Victims of Islamic Terror.htm HTML File 2.9 KB Oct 1 2012 3:28 PM
The Officially Sanctioned Invasion of Greece.htm HTML File 21.6 KB Oct 1 2012 3:34 PM
The Origins Of 'Racism' - The Curious Beginnings Of A Useless Word.htm HTML File 53.2 KB Oct 1 2012 3:32 PM
The Origins of the White Man - Part I.htm HTML File 82.7 KB Oct 1 2012 3:31 PM
The Origins of the White Man - Part II.htm HTML File 85.1 KB Oct 1 2012 3:34 PM
The Origins of the Word 'Racism'.htm HTML File 18.6 KB Oct 1 2012 3:33 PM
ThePhotographersRight.pdf PDF Document 53.8 KB Oct 1 2012 3:27 PM
The Pope Must Die.htm HTML File 3.9 KB Oct 1 2012 3:32 PM
The Price White Americans Pay - Never Forget the Hmong Massacre.htm HTML File 12.7 KB Oct 1 2012 3:33 PM
The Price White Americans Pay - Never Forget the Hmong Massacre.pdf PDF Document 320 KB Oct 1 2012 3:34 PM
thequietscourge.html HTML File 5 KB Oct 1 2012 3:31 PM
The Racial Ideology of Empire.htm HTML File 122.3 KB Oct 1 2012 3:31 PM
The Rednecks Did It!.htm HTML File 3.6 KB Oct 1 2012 3:32 PM
There is No Freedom Without Free Speech.htm HTML File 14.3 KB Oct 1 2012 3:31 PM
There is No Ghetto Pass.htm HTML File 3.6 KB Oct 1 2012 3:31 PM
There is no place for such a regime in the family of nations.txt Text File 4.1 KB Oct 1 2012 3:30 PM
The Resurrector.pdf PDF Document 135.9 KB Oct 1 2012 3:31 PM
The Rise of the BNP.htm HTML File 3.9 KB Oct 1 2012 3:34 PM
The Self-Evident Lessons of Madrid.htm HTML File 8.3 KB Oct 1 2012 3:31 PM
The Shame of Being an American.htm HTML File 20.2 KB Oct 1 2012 3:28 PM
The Shocking Story of Approved Killing in Mississippi.htm HTML File 37.7 KB Oct 1 2012 3:29 PM
The Struggle for Caucasia.htm HTML File 15.8 KB Oct 1 2012 3:33 PM
The Symbiants.htm HTML File 8.3 KB Oct 1 2012 3:27 PM
thetanserstudy.html HTML File 7.8 KB Oct 1 2012 3:32 PM
The Tapes the Hague Tribunal Hasn't Shown - Muslim Terrorists Massacring Serbs.htm HTML File 2.7 KB Oct 1 2012 3:31 PM
The Truth About Slavery.htm HTML File 23.4 KB Oct 1 2012 3:34 PM
The Truth About Tuskegee.htm HTML File 29 KB Oct 1 2012 3:29 PM
The United Israeli Emirates of North America.htm HTML File 5.8 KB Oct 1 2012 3:32 PM
The United States of Barbarism.htm HTML File 3.9 KB Oct 1 2012 3:34 PM
TheWatchdogs.pdf PDF Document 807.5 KB Oct 1 2012 3:28 PM
TheWayForward.pdf PDF Document 579.5 KB Oct 1 2012 3:32 PM
The Weird Wild World of the Zionist Right.htm HTML File 5.8 KB Oct 1 2012 3:30 PM
The Weird World of Kwanzaa and Other African Hoaxes.htm HTML File 9.3 KB Oct 1 2012 3:33 PM
The Whitewashing of Ariel Sharon.htm HTML File 3.6 KB Oct 1 2012 3:33 PM
The Winds of Change.htm HTML File 29.3 KB Oct 1 2012 3:28 PM
The World is His China Shop and His Shills Make Excuses.htm HTML File 9.7 KB Oct 1 2012 3:27 PM
The Wrath of Ka.htm HTML File 5.8 KB Oct 1 2012 3:34 PM
They Want Our Kids.htm HTML File 2.2 KB Oct 1 2012 3:33 PM
theywereslaves.pdf PDF Document 3.3 MB Oct 1 2012 3:28 PM
theywereslaves.rtf RTF File 2.4 MB Oct 1 2012 3:28 PM
The Zambotistas and the Moslemoids versus the Neo-Cons.htm HTML File 3.6 KB Oct 1 2012 3:34 PM
The_Jews_in_England_part2.html HTML File 38.3 KB Oct 1 2012 3:28 PM
the_talmud.pdf PDF Document 199.5 KB Oct 1 2012 3:33 PM
the_truth.pdf PDF Document 280.2 KB Oct 1 2012 3:34 PM
thinking.htm HTML File 24.9 KB Oct 1 2012 3:33 PM
ThinkingAboutNeocons.pdf PDF Document 147.4 KB Oct 1 2012 3:30 PM
ThisTimeTheWorld.pdf PDF Document 594.1 KB Oct 1 2012 3:33 PM
ThisTimeTheWorld.rtf RTF File 1.1 MB Oct 1 2012 3:27 PM
This Will Come Back to Haunt Us.htm HTML File 9.6 KB Oct 1 2012 3:31 PM
Thomas Carlyle and Edward Bulwer-Lytton - Giants of the North.htm HTML File 50.6 KB Oct 1 2012 3:27 PM
Thomas Jefferson - Letter to the Secretary of the Treasury Albert Gallatin.txt Text File 756 Bytes Oct 1 2012 3:33 PM
Thomas W. Chittum - Civil War II.pdf PDF Document 2.3 MB Oct 1 2012 3:28 PM
thousandsattendvoodoofestival.html HTML File 4 KB Oct 1 2012 3:33 PM
Thousands Protest Violence in Darfur.htm HTML File 3.4 KB Oct 1 2012 3:33 PM
Threats to a Free Internet.htm HTML File 17.2 KB Oct 1 2012 3:27 PM
ThunderDome.htm HTML File 3.5 KB Oct 1 2012 3:33 PM
ThusSpakeZarathustra.pdf PDF Document 917.3 KB Oct 1 2012 3:33 PM
tiffany_long.pdf PDF Document 497.5 KB Oct 1 2012 3:33 PM
tilak-pdf.zip ZIP Archive 1.6 MB Oct 1 2012 3:30 PM
Tiny Differences, Through Time, are Everything.htm HTML File 30.2 KB Oct 1 2012 3:31 PM
tipsforthewrittenexamination.pdf PDF Document 170.4 KB Oct 1 2012 3:30 PM
tob_shebbe_goyim_harog_first6.pdf PDF Document 757.5 KB Oct 1 2012 3:31 PM
Today Show - Let 'Em Eat Cake.htm HTML File 2.7 KB Oct 1 2012 3:33 PM
Tolerance.pdf PDF Document 177.3 KB Oct 1 2012 3:33 PM
Tolerance.zip ZIP Archive 76.6 KB Oct 1 2012 3:31 PM
Tom Quick (1851) JR.pdf PDF Document 459.2 KB Oct 1 2012 3:28 PM
Tonight - Current Issues TV to Host Dr. David Duke.htm HTML File 3.6 KB Oct 1 2012 3:34 PM
Toni Morrison - She Simply Can't Write.htm HTML File 4.6 KB Oct 1 2012 3:33 PM
Tookie's 'Peaceful' Pals Threaten Violence.htm HTML File 3 KB Oct 1 2012 3:30 PM
Tookie Advocate - 'That’s a racist question!'.htm HTML File 3.4 KB Oct 1 2012 3:31 PM
Tookie Finally Ready to Snitch.htm HTML File 4.3 KB Oct 1 2012 3:34 PM
Too White, Too Strong.htm HTML File 9.2 KB Oct 1 2012 3:28 PM
too_white.pdf PDF Document 455.6 KB Oct 1 2012 3:33 PM
too_white_sm.pdf PDF Document 459.6 KB Oct 1 2012 3:33 PM
Top Rabbi - Katrina is God's Punishment for Not Supporting Israel.htm HTML File 2.7 KB Oct 1 2012 3:29 PM
tor2005-224.pdf PDF Document 188.7 KB Oct 1 2012 3:34 PM
Toronto Rampage Flyer.pdf PDF Document 51.3 KB Oct 1 2012 3:29 PM
Tourists Evacuated from Superdome.htm HTML File 3 KB Oct 1 2012 3:30 PM
Tourists Targeted in New Orleans as Unrest Spreads to Baton Rouge.htm HTML File 4.2 KB Oct 1 2012 3:33 PM
traffic.pdf PDF Document 418.6 KB Oct 1 2012 3:28 PM
Troops Back From Iraq Find Another War Zone.htm HTML File 13.9 KB Oct 1 2012 3:28 PM
Troops Find Grisly Scenes in New Orleans Convention Center.htm HTML File 4.9 KB Oct 1 2012 3:33 PM
trr.pdf PDF Document 4.2 MB Oct 1 2012 3:31 PM
trr.zip ZIP Archive 1.4 MB Oct 1 2012 3:32 PM
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast.htm HTML File 145.1 KB Oct 1 2012 3:31 PM
Truthdig - Reports - Tom Hayden Things Come ’Round in Mideast2.htm HTML File 143 KB Oct 1 2012 3:27 PM
Turkey, EU Reach Deal for Opening Talks.htm HTML File 3.7 KB Oct 1 2012 3:29 PM
Turkey Has No Friends; Good for Europe.htm HTML File 5.4 KB Oct 1 2012 3:30 PM
Turkey Wins Censorship of Armenian Genocide in German Schools.htm HTML File 3.9 KB Oct 1 2012 3:33 PM
Turkish Novelist Faces Jail for ‘Hate Speech’.htm HTML File 4.9 KB Oct 1 2012 3:33 PM
Turks Award Zionists with Weapons Contract.htm HTML File 2.3 KB Oct 1 2012 3:34 PM
Turks Convict Armenian Journalist of 'Speech Crime'.htm HTML File 3.9 KB Oct 1 2012 3:30 PM
Turks May Save Drowning Rat.htm HTML File 3.5 KB Oct 1 2012 3:28 PM
TurnerDiaries.pdf PDF Document 809.7 KB Oct 1 2012 3:32 PM
TurnerDiaries.rtf RTF File 1.9 MB Oct 1 2012 3:31 PM
turnerdiaries.zip ZIP Archive 279 KB Oct 1 2012 3:34 PM
turn_it_down_resource_kit.pdf PDF Document 507.9 KB Oct 1 2012 3:28 PM
Two More 'Sexual Indoctrination' Bills Vetoed.htm HTML File 3 KB Oct 1 2012 3:27 PM
TWPL_Final.pdf PDF Document 3 MB Oct 1 2012 3:33 PM
U.S. Population Nears 300 Million.htm HTML File 5.4 KB Oct 1 2012 3:31 PM
U.S.S. Liberty,.html HTML File 56.9 KB Oct 1 2012 3:33 PM
U.S.S. Liberty Crew Reunites.htm HTML File 3.8 KB Oct 1 2012 3:33 PM
U.S. State Department - Israel Plagued by Trafficking.htm HTML File 3.3 KB Oct 1 2012 3:31 PM
Ugly Lessons from Katrina.htm HTML File 3.7 KB Oct 1 2012 3:28 PM
UK - Al Qaeda 'Cleric' Worked for Both Sides.htm HTML File 4.4 KB Oct 1 2012 3:32 PM
UK - Birmingham Riots Result of Multicultural Experiment.htm HTML File 3.3 KB Oct 1 2012 3:32 PM
UK - Black Gets Prison for al-Qaeda Plot.htm HTML File 2.8 KB Oct 1 2012 3:33 PM
UK - BNP Music Label Launched.htm HTML File 4.2 KB Oct 1 2012 3:28 PM
UK - BNP Picking Up Votes - Viewed as Persecuted Underdog.htm HTML File 5 KB Oct 1 2012 3:32 PM
UK - British National Party Chairman Nick Griffin Released.htm HTML File 7.1 KB Oct 1 2012 3:29 PM
UK - Censorship by Multiracialists Raises Ugly Head.htm HTML File 4.6 KB Oct 1 2012 3:32 PM
UK - Conservatives Fear Nationalist Competition.htm HTML File 7.5 KB Oct 1 2012 3:31 PM
UK - English Town Continues to Suffer From Multiracialism.htm HTML File 3.1 KB Oct 1 2012 3:31 PM
UK - Jews Condemned for Throat-Cutting Ritual.htm HTML File 1.7 KB Oct 1 2012 3:31 PM
UK - Keighley Protest Still On.htm HTML File 3.9 KB Oct 1 2012 3:29 PM
UK - Muslims Scream About Ice Cream.htm HTML File 4.7 KB Oct 1 2012 3:31 PM
UK - National Demonstration Against Police Anti-White Racism Planned.htm HTML File 7.6 KB Oct 1 2012 3:28 PM
UK - Nov. 2 Free Speech Demo Plan Forges Ahead.htm HTML File 4.1 KB Oct 1 2012 3:28 PM
UK - Now It's Griffin.htm HTML File 12.3 KB Oct 1 2012 3:31 PM
UK - Police Arrest Anti-White Goon.htm HTML File 4 KB Oct 1 2012 3:33 PM
UK - Police Investigating Multiracialist Entertainer for Threatening Whites.htm HTML File 3.2 KB Oct 1 2012 3:27 PM
UK - Popular Muslim Video Supports Violence Against Non-Believers.htm HTML File 4.3 KB Oct 1 2012 3:33 PM
UK - Race Rioting Erupts in Birmingham.htm HTML File 13.5 KB Oct 1 2012 3:31 PM
UK - Racial Justice Sunday Staged by Rapidly Shrinking Church.htm HTML File 7.8 KB Oct 1 2012 3:31 PM
UK - Secret Police Seize Nationalist Paper.htm HTML File 10.6 KB Oct 1 2012 3:30 PM
UK - Top Cop Urges Police To Wear Islamic Battle Colors.htm HTML File 7.2 KB Oct 1 2012 3:30 PM
UK - White Leaders Undaunted by Coordinated Violent Attacks.htm HTML File 4 KB Oct 1 2012 3:30 PM
UK - Whites Furious Over Removal of Memorial To Slain Teenager.htm HTML File 3.4 KB Oct 1 2012 3:28 PM
UK - Whites Quitting Cities.htm HTML File 3.5 KB Oct 1 2012 3:33 PM
UK = Church Anger at Islamic Texts.htm HTML File 4.4 KB Oct 1 2012 3:33 PM
UK Cops Threaten Vet Over Flag.htm HTML File 9.7 KB Oct 1 2012 3:31 PM
UK journalist arrested in Israel.htm HTML File 5.1 KB Oct 1 2012 3:33 PM
Ukraine - David Duke Earns Doctorate in History.htm HTML File 12.5 KB Oct 1 2012 3:33 PM
Ulster - Anti-White Loyalist Thug Slain.htm HTML File 7.4 KB Oct 1 2012 3:32 PM
Ulster - Loyalists Join Jews in Human Smuggling Ring.htm HTML File 5.7 KB Oct 1 2012 3:27 PM
Ulster - Religious Fanatics Say No To Catholics, Yes To Non-Whites.htm HTML File 3.8 KB Oct 1 2012 3:27 PM
Ulster-Scots Culture Enjoys a Renaissance.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
ulysses.pdf PDF Document 1 MB Oct 1 2012 3:30 PM
ulysses.rtf RTF File 3.9 MB Oct 1 2012 3:30 PM
UMBCTeenDrivingStudy.pdf PDF Document 473.9 KB Oct 1 2012 3:33 PM
UN Antislavery Day Celebrates Massacre of Whites.htm HTML File 3 KB Oct 1 2012 3:27 PM
UnderstandingJewInfluence.pdf PDF Document 240.2 KB Oct 1 2012 3:33 PM
Underst_White_Priv.pdf PDF Document 1002 KB Oct 1 2012 3:27 PM
UniqueWesternCulture.pdf PDF Document 136.8 KB Oct 1 2012 3:28 PM
Updated - Who Rules America.htm HTML File 50 KB Oct 1 2012 3:30 PM
upperclassblackstudentsunderperforming.html HTML File 7.1 KB Oct 1 2012 3:33 PM
Uprising.pdf PDF Document 2.5 MB Oct 1 2012 3:32 PM
urban guerilla.pdf PDF Document 73.2 KB Oct 1 2012 3:31 PM
US - White Poverty Soars.htm HTML File 2.4 KB Oct 1 2012 3:32 PM
usbegsjewstostopsellingmilitarytechnologytochina.html HTML File 3.4 KB Oct 1 2012 3:32 PM
uscollegetestatcenterofracechargeddebate.html HTML File 5.8 KB Oct 1 2012 3:31 PM
US Condemns 14 Countries for Human Trafficking.htm HTML File 2.1 KB Oct 1 2012 3:33 PM
US Evangelicals Increasingly Question Pro-Zionist Heresy.htm HTML File 2.3 KB Oct 1 2012 3:28 PM
US Iraq Atrocities Nothing New.htm HTML File 4.5 KB Oct 1 2012 3:31 PM
US Left - Tools of Oligarchs, Zionists, System.htm HTML File 4.8 KB Oct 1 2012 3:31 PM
US Nationalists Record Song for BNP.htm HTML File 3.3 KB Oct 1 2012 3:29 PM
US Provided KLA With Food.htm HTML File 2.3 KB Oct 1 2012 3:28 PM
usseekstocurbisraeliarmssalestochina.html HTML File 15.3 KB Oct 1 2012 3:33 PM
USS LIBERTY Memorial - AMERICAN LEADERS SUPPORT USS Liberty SURVIVORS.htm HTML File 84 KB Oct 1 2012 3:28 PM
USS Liberty Veterans Present Pentagon With Report on Israeli War Crimes.htm HTML File 33.2 KB Oct 1 2012 3:31 PM
ustechnologyappearsinnewchinesewarplaneviaisrael.html HTML File 12.4 KB Oct 1 2012 3:27 PM
Usury Perfected.htm HTML File 2.1 KB Oct 1 2012 3:28 PM
Utahns Leaving Multiracial Public Schools.htm HTML File 3.2 KB Oct 1 2012 3:30 PM
V-News.org Exclusive - The Plan De San Diego.htm HTML File 6.3 KB Oct 1 2012 3:31 PM
Vang Guilty in Hunter Massacre Trial.htm HTML File 3.9 KB Oct 1 2012 3:30 PM
Vang Says Three Hunters Deserved to Die.htm HTML File 2.8 KB Oct 1 2012 3:34 PM
Vanguard News Network » Blog Archive » Important Thoughts, Financial and Economic Advice.htm HTML File 115.3 KB Oct 1 2012 3:30 PM
Vanunu - Israel's Nuclear Arsenal a Threat to Middle East.htm HTML File 4.1 KB Oct 1 2012 3:32 PM
vargsmal.zip ZIP Archive 101.3 KB Oct 1 2012 3:33 PM
Venezuelan Chavez wants to be world's anti-U.S. voice.htm HTML File 10.3 KB Oct 1 2012 3:30 PM
Veteran Congressman Paul Findley Exposes Israel’s Lobby.htm HTML File 7.3 KB Oct 1 2012 3:32 PM
vfsky.pdf PDF Document 82.6 KB Oct 1 2012 3:31 PM
VH.zip ZIP Archive 1.9 MB Oct 1 2012 3:31 PM
video.html HTML File 49.8 KB Oct 1 2012 3:32 PM
Vigilantes Attack Elderly Border Protestors.htm HTML File 3.4 KB Oct 1 2012 3:33 PM
Viktor Schauberger.txt Text File 11.1 KB Oct 1 2012 3:33 PM
Viroqua, WI School Board Bans 'Diversity Day'.htm HTML File 6 KB Oct 1 2012 3:31 PM
VirusHouse.pdf PDF Document 2 MB Oct 1 2012 3:31 PM
vnntaa1a.pdf PDF Document 1.3 MB Oct 1 2012 3:33 PM
vnntaa2.pdf PDF Document 1.7 MB Oct 1 2012 3:32 PM
vnntaa3.pdf PDF Document 1.4 MB Oct 1 2012 3:28 PM
Vof64-1.pdf PDF Document 1.6 MB Oct 1 2012 3:31 PM
Vof64-2.pdf PDF Document 629.4 KB Oct 1 2012 3:31 PM
Vof64-3.pdf PDF Document 649.3 KB Oct 1 2012 3:28 PM
Vof64-4.pdf PDF Document 915.2 KB Oct 1 2012 3:31 PM
Vof64-5.pdf PDF Document 344.4 KB Oct 1 2012 3:27 PM
Vof64-6.pdf PDF Document 543.3 KB Oct 1 2012 3:33 PM
Vof64-7.pdf PDF Document 564 KB Oct 1 2012 3:31 PM
Vof64-8.pdf PDF Document 8 MB Oct 1 2012 3:28 PM
Vof64-9.pdf PDF Document 8.6 MB Oct 1 2012 3:34 PM
Vof64-10.pdf PDF Document 655.5 KB Oct 1 2012 3:27 PM
Vof64-11.pdf PDF Document 831.1 KB Oct 1 2012 3:32 PM
Vof64-12.pdf PDF Document 462.8 KB Oct 1 2012 3:28 PM
Vof64-13.pdf PDF Document 1 MB Oct 1 2012 3:33 PM
Vof64-14.pdf PDF Document 1 MB Oct 1 2012 3:33 PM
Vof64-15.pdf PDF Document 2.1 MB Oct 1 2012 3:34 PM
Vof64-16.pdf PDF Document 3.2 MB Oct 1 2012 3:28 PM
Voice For Europe - Pan-European Co-ordination Against Turkish EU Membership.htm HTML File 3.2 KB Oct 1 2012 3:27 PM
Voices from the Past - Languages of Our Ancestors.htm HTML File 3.4 KB Oct 1 2012 3:31 PM
Voodoo Faithful on Annual Pilgrimage.htm HTML File 3.1 KB Oct 1 2012 3:34 PM
Voting for Pro-White Parties Is 'Spitting in God's Face'.htm HTML File 4.8 KB Oct 1 2012 3:33 PM
Wal-Mart Turns in Student’s Anti-Bush Photo, Secret Service Investigates Him.htm HTML File 4 KB Oct 1 2012 3:30 PM
Wales - Win for 'Heretic'.htm HTML File 4.2 KB Oct 1 2012 3:33 PM
WalkerIndictment.pdf PDF Document 149.5 KB Oct 1 2012 3:33 PM
WallStreetCommieRevolution.pdf PDF Document 586.2 KB Oct 1 2012 3:31 PM
WarBetweenGenerals.pdf PDF Document 3.6 MB Oct 1 2012 3:33 PM
War Criminal at Bay.htm HTML File 3.9 KB Oct 1 2012 3:31 PM
WarIsARacket.pdf PDF Document 42.6 KB Oct 1 2012 3:30 PM
War Party Atrocity Porn.htm HTML File 2.9 KB Oct 1 2012 3:30 PM
WarPath.pdf PDF Document 2.4 MB Oct 1 2012 3:31 PM
War Signals.htm HTML File 2.9 KB Oct 1 2012 3:32 PM
WAR_AryanUpdates2003_02_01_00_99.pdf PDF Document 3.4 MB Oct 1 2012 3:31 PM
WAR_AryanUpdates2004_03_02.pdf PDF Document 3.3 MB Oct 1 2012 3:31 PM
Was Columbus Greek.htm HTML File 6 KB Oct 1 2012 3:31 PM
WAS THERE REALLY A HOLOCAUST.htm HTML File 19.7 KB Oct 1 2012 3:28 PM
Was WWII Worth It.htm HTML File 6.7 KB Oct 1 2012 3:29 PM
WATCHING.pdf PDF Document 80.6 KB Oct 1 2012 3:27 PM
Watts Riots 40 Years On.htm HTML File 2.8 KB Oct 1 2012 3:33 PM
wausau.htm HTML File 38.7 KB Oct 1 2012 3:32 PM
WausauImmigration.pdf PDF Document 38.5 KB Oct 1 2012 3:30 PM
WausauImmigration.rtf RTF File 64 KB Oct 1 2012 3:28 PM
WealthOfNations.pdf PDF Document 1.4 MB Oct 1 2012 3:28 PM
We at The Scriptorium.htm HTML File 15.5 KB Oct 1 2012 3:33 PM
weekly report 01.pdf PDF Document 363.3 KB Oct 1 2012 3:31 PM
Welcome, TAA#3 readers - Background on our authors subjects.htm HTML File 71.3 KB Oct 1 2012 3:33 PM
Welcome News - Turks May 'Shun' EU Talks.htm HTML File 3.7 KB Oct 1 2012 3:31 PM
Welcome to the Jungle - Superdome Tales.htm HTML File 3 KB Oct 1 2012 3:31 PM
Wendy Campbell - 2006-09-11 - Parallels between Nazism, Zionists striking.htm HTML File 29.5 KB Oct 1 2012 3:30 PM
We The People.htm HTML File 3.7 KB Oct 1 2012 3:33 PM
What's in the New Orleans Water.htm HTML File 5.5 KB Oct 1 2012 3:29 PM
What's This About 'Peak Oil'.htm HTML File 4.5 KB Oct 1 2012 3:33 PM
What's Your Diversity Quotient.htm HTML File 15.1 KB Oct 1 2012 3:31 PM
What About 'Affirmative Action' for US Media Ownership.htm HTML File 15.4 KB Oct 1 2012 3:28 PM
What Does Israel Want.htm HTML File 2.6 KB Oct 1 2012 3:31 PM
What is National Vanguard - intro.pdf PDF Document 1.4 MB Oct 1 2012 3:32 PM
What is National Vanguard.htm HTML File 22.7 KB Oct 1 2012 3:31 PM
What is So Wrong With White People.htm HTML File 8.2 KB Oct 1 2012 3:31 PM
What Makes Palestinians Think They Can.htm HTML File 7.6 KB Oct 1 2012 3:28 PM
What Makes Western Culture Unique.htm HTML File 4.8 KB Oct 1 2012 3:29 PM
whatsnew.htm HTML File 6.4 KB Oct 1 2012 3:28 PM
WhatTheTalmudTeaches.pdf PDF Document 213 KB Oct 1 2012 3:34 PM
What will become of the ‘American Dream’.htm HTML File 4.9 KB Oct 1 2012 3:31 PM
What Would War Look Like.htm HTML File 5.4 KB Oct 1 2012 3:32 PM
Wheat and Chaff.htm HTML File 4.1 KB Oct 1 2012 3:33 PM
When Al Qaeda Was An Ally of 'the West'.htm HTML File 4.7 KB Oct 1 2012 3:31 PM
When In Our Music God Is Glorified.doc Microsoft Word Document 20.5 KB Oct 1 2012 3:27 PM
where_are_wmd.pdf PDF Document 92 KB Oct 1 2012 3:31 PM
Which Way, Milwaukee.htm HTML File 14.8 KB Oct 1 2012 3:31 PM
WhiteAmerica.pdf PDF Document 527.7 KB Oct 1 2012 3:32 PM
White America starts winning.htm HTML File 7 KB Oct 1 2012 3:31 PM
White Children Experience Slavery at Summer Camp.htm HTML File 3 KB Oct 1 2012 3:30 PM
White Heritage Sites Threatened on Cyprus.htm HTML File 3.8 KB Oct 1 2012 3:33 PM
White India.htm HTML File 4.7 KB Oct 1 2012 3:27 PM
White Interests.htm HTML File 3.1 KB Oct 1 2012 3:33 PM
WhiteMansBibleOrig.pdf PDF Document 1.3 MB Oct 1 2012 3:28 PM
White Nationalist Position Statements.pdf PDF Document 55.7 KB Oct 1 2012 3:27 PM
White Nationalist Position Statements.txt Text File 7 KB Oct 1 2012 3:30 PM
White People's Party Forms in Nevada.htm HTML File 5.4 KB Oct 1 2012 3:34 PM
WhitePower.pdf PDF Document 766.1 KB Oct 1 2012 3:27 PM
whitesblacks100factsandonelie.html HTML File 62.2 KB Oct 1 2012 3:31 PM
White Science, Black Humor.htm HTML File 13.7 KB Oct 1 2012 3:30 PM
WhiteSlaveryBibliography.pdf PDF Document 72.1 KB Oct 1 2012 3:27 PM
White Slavery Focus of New Book.htm HTML File 2.6 KB Oct 1 2012 3:32 PM
Whites Make Stand at Superdome.htm HTML File 3.2 KB Oct 1 2012 3:31 PM
Whites Organize in Namibia.htm HTML File 2.8 KB Oct 1 2012 3:31 PM
Whites Repulse Turks in Georgian Waters.htm HTML File 5.3 KB Oct 1 2012 3:33 PM
Whites Suffering in New Orleans.htm HTML File 3.2 KB Oct 1 2012 3:27 PM
White Teen Dragged from Bus, Beaten, and Robbed by Anti-White Gang Members.htm HTML File 2.3 KB Oct 1 2012 3:31 PM
White Wire Newsblog » A History of Kwanza by Ann Coulter…and a Special Kwanza Jingle From the White Wire Staff.htm HTML File 20.7 KB Oct 1 2012 3:33 PM
Who Brought the Slaves to America -- part II of II.htm HTML File 28.4 KB Oct 1 2012 3:31 PM
Who Brought the Slaves to America -- part I of II.htm HTML File 20.7 KB Oct 1 2012 3:31 PM
Who Rules America.htm HTML File 49.6 KB Oct 1 2012 3:32 PM
WhoRulesAmerica.pdf PDF Document 51.2 KB Oct 1 2012 3:31 PM
Who We Sold the Serbs To.htm HTML File 6.6 KB Oct 1 2012 3:33 PM
WhoWillFeedChina.pdf PDF Document 43.5 KB Oct 1 2012 3:30 PM
whydoblackstudentslagbehind.html HTML File 15.7 KB Oct 1 2012 3:28 PM
Why Hitler Attacked Soviet Russia When He Did.htm HTML File 31.5 KB Oct 1 2012 3:31 PM
whyisafricapoor.html HTML File 19.7 KB Oct 1 2012 3:28 PM
Why Islam Didn't Conquer the World.htm HTML File 6.6 KB Oct 1 2012 3:30 PM
Why Israel’s Campaign in Lebanon is Failing.htm HTML File 8.8 KB Oct 1 2012 3:33 PM
Why Scandinavia Tops U.N. Standard of Living Index.htm HTML File 3.8 KB Oct 1 2012 3:31 PM
why_reverse_evolution.pdf PDF Document 209.4 KB Oct 1 2012 3:33 PM
why_reverse_evolution_color.pdf PDF Document 629.2 KB Oct 1 2012 3:34 PM
WichitaMassacre.pdf PDF Document 520.3 KB Oct 1 2012 3:28 PM
WichitaMassacreHomepage.pdf PDF Document 957.5 KB Oct 1 2012 3:30 PM
wiesenthal - fake holocaust.htm HTML File 15.9 KB Oct 1 2012 3:27 PM
Wife-Beating Drug Addict Demands Custody Of Prussian Blue.txt Text File 2.2 KB Oct 1 2012 3:30 PM
Wife19.pdf PDF Document 8.1 MB Oct 1 2012 3:33 PM
WinterSonnenWend.pdf PDF Document 1.5 MB Oct 1 2012 3:31 PM
wiretap.pdf PDF Document 453.6 KB Oct 1 2012 3:29 PM
Wisconsin - New Flood of Hmong Refugees Will Strain Already Tight Budgets.htm HTML File 5.7 KB Oct 1 2012 3:33 PM
Wisconsin - Rampage Killer, Friends Now Suspects in 2001 Homicide.htm HTML File 7.1 KB Oct 1 2012 3:27 PM
Wisconsin Loves Its Non-Whites Too.htm HTML File 5.8 KB Oct 1 2012 3:31 PM
Witnesses - New Orleans Cops are Looters.htm HTML File 3.2 KB Oct 1 2012 3:28 PM
WKRC_UAS.wmv WMV File 5.8 MB Oct 1 2012 3:28 PM
wmb.pdf PDF Document 1.3 MB Oct 1 2012 3:31 PM
wn-urls.txt Text File 4.7 KB Oct 1 2012 3:33 PM
wood103.pdf PDF Document 196.8 KB Oct 1 2012 3:31 PM
Worldwide Lack of Concern Over Israel's White Slave Trade.htm HTML File 4.5 KB Oct 1 2012 3:33 PM
WPP Guidelines.pdf PDF Document 21.3 KB Oct 1 2012 3:33 PM
WPP Petition.pdf PDF Document 723.2 KB Oct 1 2012 3:27 PM
WPP Platform.pdf PDF Document 57.5 KB Oct 1 2012 3:31 PM
wra.pdf PDF Document 289.2 KB Oct 1 2012 3:31 PM
wra2004.pdf PDF Document 899.9 KB Oct 1 2012 3:32 PM
wraflyer.pdf PDF Document 45.4 KB Oct 1 2012 3:32 PM
WSCwrote1920.html HTML File 11.1 KB Oct 1 2012 3:33 PM
wtc1.pdf PDF Document 5.3 MB Oct 1 2012 3:31 PM
WTC 911 plot.pdf PDF Document 334.7 KB Oct 1 2012 3:31 PM
WTC_1page.pdf PDF Document 5.3 MB Oct 1 2012 3:33 PM
wvr.pdf PDF Document 13.2 MB Oct 1 2012 3:34 PM
yellow.pdf PDF Document 1 MB Oct 1 2012 3:33 PM
YGGDRASIL - Lesson Number One.htm HTML File 21.4 KB Oct 1 2012 3:27 PM
YggdrasilsLibrary.pdf PDF Document 3.1 MB Oct 1 2012 3:30 PM
YggLibraryFull.pdf PDF Document 4.3 MB Oct 1 2012 3:31 PM
youre_fired.pdf PDF Document 1.3 MB Oct 1 2012 3:28 PM
Youth Gang Rape Reported in Milwaukee.htm HTML File 6.5 KB Oct 1 2012 3:28 PM
Zimbabwe - Armed Police Stealing Farm Equipment.htm HTML File 3.9 KB Oct 1 2012 3:28 PM
Zimbabwe - Monkey Behind Famine.htm HTML File 3.2 KB Oct 1 2012 3:31 PM
ZionismInAgeOfDictators.pdf PDF Document 1.3 MB Oct 1 2012 3:28 PM
ZionistAntiSemitism.pdf PDF Document 32.7 KB Oct 1 2012 3:28 PM
zionistcoverup.pdf PDF Document 1.4 MB Oct 1 2012 3:33 PM
zionistcoverup.rtf RTF File 1 MB Oct 1 2012 3:31 PM
Zionists Cheer Creep DeLay.htm HTML File 3.7 KB Oct 1 2012 3:28 PM
Zionist Shill's Mistake Endangers Family.htm HTML File 3.9 KB Oct 1 2012 3:28 PM
Zionists Show Contempt For Christians.htm HTML File 3.4 KB Oct 1 2012 3:28 PM
Zionists Slam Greeks.htm HTML File 3.9 KB Oct 1 2012 3:30 PM
Zionists Threaten Leader with Occult Ritual Murder.htm HTML File 8 KB Oct 1 2012 3:28 PM
Zionist Televangelist Paid Hush Money in 'Gay' Scandal.htm HTML File 4.1 KB Oct 1 2012 3:30 PM
Zionist Thug Invaders Stir Plate of Violence for Passover Celebrations, Celebrate the Cruel Killing of Innocent Egyptian Children 3,000 Years Ago..html HTML File 14.4 KB Oct 1 2012 3:31 PM
zogencryption.htm HTML File 21.4 KB Oct 1 2012 3:27 PM
ZweitesBuch.pdf PDF Document 324.9 KB Oct 1 2012 3:32 PM
ZyklonAd-War.pdf PDF Document 313 KB Oct 1 2012 3:33 PM
‘Patriotism’ is the Last Refuge of the Scoundrel.htm HTML File 4.9 KB Oct 1 2012 3:32 PM
The preterhuman.net network is powered by Altexxa Group. Our partners include CupidClick Dating, Canhost, OMGWTFBBQ.